KEGG   Helicobacter pylori F32: HPF32_0449Help
Entry
HPF32_0449        CDS       T01911                                 

Gene name
ackA_pta
Definition
(GenBank) fusion protein of phosphotransacetylase and acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
heq  Helicobacter pylori F32
Pathway
heq00430  Taurine and hypotaurine metabolism
heq00620  Pyruvate metabolism
heq00640  Propanoate metabolism
heq00680  Methane metabolism
heq01100  Metabolic pathways
heq01120  Microbial metabolism in diverse environments
heq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:heq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPF32_0449 (ackA_pta)
   00640 Propanoate metabolism
    HPF32_0449 (ackA_pta)
  09102 Energy metabolism
   00680 Methane metabolism
    HPF32_0449 (ackA_pta)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    HPF32_0449 (ackA_pta)
Enzymes [BR:heq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     HPF32_0449 (ackA_pta)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase PTA_PTB AAA_26
Motif
Other DBs
NCBI-ProteinID: BAJ58031
UniProt: E6NNV5
Position
479334..481208
Genome map
AA seq 624 aa AA seqDB search
MQSFMQSFMQSLWIYPEDTEVLGVACKSLLKALKPHYQKIALFSPIRPYDGGCEGFLGCY
GLNSLEFHSAIDKQKALELVSTDQEELLFETILKRYDELQTTHDFVINLGYAPKFFLNAL
LDLNTTLAKHLNAPIVAVAQTSLEYLKAMHSHILKKEAPFAVGLFAGEMLEKPNFLSASL
CKQRCELEADLIESVLQTKSEITTPLAFQMGLEKKAKKQIKKVVLPESEDERILKAVHRL
NAMGAVGLILLGDKEAISSQAKNLNLNLENVEIIDPNTSHYKEEFANHLYELRKSKGLSE
QEAKQLVLDKTYFATMLVHSGYAHAMVSGVNRTTAETIRPALQIIKTKPGVSLVSSVFLM
CLDTQVLVFGDCAIIPNPSPNYAYMYALPYELYEKYQIRRYGFHGTSHHYVTKEAAKFLN
IAYEEFNAISLHLGNGSSAAAIQKGKSVDTSMGLTPLEGLIMGTRCGDIDPTVVEYIAQC
ANKSLEEVMKILNHESGLKGICGDNDARNIEARKEKGDKQAKLAFEMCAYRIKKHIGAYM
AVLKKVDAIIFTGGLGENYSALRESVCEGLEDLGIALHKPTNDNPGNGLVDLSQPDTKVK
VLLIPTDEELEIAIQAKEIVEKLK
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagtttcatgcaaagtttcatgcaaagtttgtggatttacccagaagatacagaa
gttttaggggttgcttgtaagagccttttaaaagcgctaaagccgcactatcaaaaaatc
gcattgttttcgcccattcgcccatatgatggggggtgtgagggctttttggggtgctat
ggcttgaattctttagagtttcatagcgccatagacaaacaaaaggctttagagcttgtg
agcactgatcaagaagagttattatttgaaacgattctcaaacgctacgatgaattacaa
accacgcatgactttgtcattaatttagggtatgcgccgaagtttttcttaaacgctctt
ttagatttaaacaccactttagccaagcatttaaacgctcctattgtggctgttgcgcaa
acgagtttggaatatttgaaagccatgcattctcacattctcaaaaaagaagcccctttc
gctgtagggttatttgcgggcgaaatgcttgaaaaacccaattttttaagcgcgtctctt
tgcaagcaacgatgcgaattagaagcggatctgatagaaagcgtgttgcaaacaaaaagc
gaaatcaccacccctttagcctttcaaatgggtttggaaaaaaaggctaaaaaacagatt
aaaaaagtggttttacccgagagcgaagatgaaaggattttaaaagctgtgcatcgtttg
aacgctatgggtgcggtaggattgattttattaggcgataaagaagccattagttcccaa
gcaaaaaatttgaacttgaatttagaaaatgtagaaatcattgatcctaacacttctcat
tataaagaagaattcgctaatcatttgtatgaattgcgaaaatcaaagggcttgagtgag
caagaagctaagcaattggtgttggataagacttattttgcgaccatgctcgtgcattca
ggctatgcacatgccatggtttctggggtgaatcgcaccacggctgagactattagaccc
gctttacaaatcattaagactaagcctggcgtgagtttggtttcaagcgtgtttttaatg
tgtttagacactcaagtgctagtctttggggattgcgcgattatccctaaccctagccct
aattacgcttacatgtatgcgttgccttatgaattgtatgaaaagtatcaaatccgccgt
tatggtttccatgggacttcacaccattatgtgactaaagaagcggcgaagtttttgaat
atcgcttatgaggaatttaacgctatcagtttgcatttagggaacggctcaagcgcagca
gccattcaaaagggtaaaagcgtggatacttctatggggctaacccctttagaaggcttg
atcatgggcacaaggtgtggggacattgatcctactgtggtggaatacatcgcgcaatgc
gctaataaaagtttagaagaagtgatgaaaattttaaaccatgaaagcggcttgaaaggc
atttgtggggataatgacgccagaaacatagaagccagaaaagaaaaaggcgataagcaa
gccaagctcgcttttgaaatgtgcgcttatcgcattaaaaagcatattggggcttacatg
gcagtcttaaaaaaagtggatgcgatcatctttacagggggattaggggaaaactactcg
gctttaagagagagcgtgtgtgaaggcttagaagatttagggattgctttgcacaagccc
accaacgacaatccgggcaacggattagtggatttgagccagcctgatactaaagttaag
gttttattaatccctactgatgaagagctagaaatcgctatacaagcgaaagaaatagta
gaaaaattaaaataa

DBGET integrated database retrieval system