KEGG   Helicobacter pylori F32: HPF32_0465Help
Entry
HPF32_0465        CDS       T01911                                 

Definition
(GenBank) hypothetical protein
Organism
heq  Helicobacter pylori F32
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FapA LOH1CR12
Motif
Other DBs
NCBI-ProteinID: BAJ58047
UniProt: E6NNX1
Position
498706..500550
Genome map
AA seq 614 aa AA seqDB search
MSLEHFAPIKVERCKDIQKELKKAAAENKLQTEDLWFEILKTSIFIKNSAKDDFSEAFGG
ELQQLEEDEYYEKKELTLYQTHDIKIKSNAYKRFFEVEVDEHWSKIEIVLDECFIVLDTE
EHYQEMFAYIKERLAFQGVVFRHLSQMYENLKTELRKYKKEAQNKRFILYASPTFIPNIE
EQSHFLLEEEYLPTHIIPLSDQEEFFVKENDYIAKENQKVACVNYPKQGKDGRNLKGLYI
ELPKVANSPTPIGHDKNAFEEREENNALVYYSKALQGVKMEKGRLVSKQNFIFKNGIKSI
ETPNLLGGVESGLVLEIQAKDELSDAIDSNLILEASAINIKGNVGKNVILVAKEITIEGQ
IHPESYVYANKARITNHKGVCYAKEFECKYLERAKVYANSVKVEASAGSVVYAKEIALEK
LKSDNKLYFSKQCLIDEVDGNGNRFIFYAFGGRENQEELKAAKQKLNALGLKSKKIIAQH
QSLNHLVKNNQVIMEKLKNATEEIKRSLMQQESVKDAYSEFMFALKRLKILKAQMLELQK
INNECYAKLISIENSFQHASIMTKNPFKQENIVIYHRNYPKVSNLSAMLSHNESVNVIYE
DHKIKKVPKSAIKG
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgagcttggagcattttgcccctataaaagttgagcggtgcaaagacattcaaaaagaa
ttaaaaaaagcggccgctgaaaataaattgcaaacagaagatctatggtttgagatttta
aaaacttctatttttatcaaaaacagcgctaaagacgattttagtgaggcttttggtggg
gaattgcaacaattagaagaagatgaatactatgaaaaaaaagagctaaccctttatcaa
acccacgacattaaaatcaaatcaaacgcttataagcgcttttttgaagtggaagtggat
gaacattggagtaaaatagaaatcgttttagacgagtgttttattgtcctagacactgaa
gagcattaccaagaaatgtttgcgtatattaaagagcgtttagcctttcaaggcgtggtg
tttcgccacctttcacaaatgtatgaaaatttaaaaacagagttaagaaaatataaaaaa
gaagcccaaaacaagcgctttattttatacgcttctccaacttttatccctaatatagaa
gaacaatcccattttttattagaagaagaataccttccaacgcacattattcccttaagc
gatcaagaagaattttttgttaaagaaaatgattatatcgctaaagaaaatcaaaaagtc
gcttgcgtgaattaccccaaacaaggcaaagacggccgtaaccttaaaggcctttatatt
gaattgcctaaagttgccaattcgcccacccctatagggcatgacaaaaacgcttttgaa
gaaagagaagaaaataacgctttagtgtattactccaaagccttacaaggggttaaaatg
gaaaaagggcgtttggtttctaagcaaaattttatttttaaaaacgggatcaagtccatt
gaaactcccaatcttttagggggagtggagagcgggttggttttagagattcaagctaaa
gatgaattgagcgatgcgattgattctaacctcattttagaagcgagcgcgattaacatt
aagggcaatgtgggcaagaatgtgatcttagtggctaaagaaattactatagaggggcaa
atccaccctgaaagctatgtctatgccaataaagcgcgtatcactaaccataagggcgtg
tgctacgctaaagagtttgagtgcaagtatttagagcgcgctaaggtgtatgccaatagc
gttaaagtggaagcgagcgcggggagcgtggtctatgcgaaagaaatcgctttagaaaag
ctcaaaagcgataacaagctgtatttttccaagcaatgtttgattgatgaagtggatggt
aatggcaaccgctttattttttacgcttttggggggcgagaaaaccaagaagaattgaaa
gccgctaaacaaaaactcaatgcgttagggttaaaatctaaaaaaattatcgctcagcac
cagtccttaaaccatttagtcaaaaataatcaagtcatcatggaaaagcttaaaaacgcc
accgaagagatcaaacgctctttaatgcaacaagaaagcgtgaaagacgcttatagcgag
ttcatgtttgccttaaagcgtttgaaaatcttaaaagcccaaatgctagaattgcaaaag
atcaataacgaatgttacgctaaactcattagcatagaaaacagcttccagcatgcaagt
attatgactaaaaaccctttcaagcaagaaaatatcgtgatctaccatcgcaattaccct
aaagtgagcaacttgagcgctatgttaagccataatgaaagcgtgaatgtgatctatgaa
gatcataaaatcaaaaaagtccctaaaagcgctataaaaggctag

DBGET integrated database retrieval system