KEGG   Helicobacter pylori F32: HPF32_0466Help
Entry
HPF32_0466        CDS       T01911                                 

Gene name
ruvA
Definition
(GenBank) Holliday junction DNA helicase motor protein
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
heq  Helicobacter pylori F32
Pathway
heq03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:heq00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    HPF32_0466 (ruvA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:heq03400]
    HPF32_0466 (ruvA)
Enzymes [BR:heq01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     HPF32_0466 (ruvA)
DNA repair and recombination proteins [BR:heq03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     HPF32_0466 (ruvA)
    RecFOR pathway proteins
     HPF32_0466 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HHH_5 RuvA_N RuvA_C HHH HHH_2 HHH_8 HHH_3 Cdd1 IMS_HHH
Motif
Other DBs
NCBI-ProteinID: BAJ58048
UniProt: E6NNX2
Position
500575..501126
Genome map
AA seq 183 aa AA seqDB search
MIVGLIGVVEKISALEAHIEVQGVVYGVQVSMRTSALLQAGQKARLKILQVIKEDAHLLY
GFLEESEKILFERLLKINGVGGRIALAILSSFSPNEFENIIATKEVKRLQQVPGIGKKLA
DKIMVDLIGFFIQDETSPTRNEVFLALESLGFKSAEINKVLKTLKPHLSTEVAIKEALQQ
LRS
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgatagtgggtttgataggggttgtggaaaaaatttctgctttagaagcacatatagaa
gtgcaaggggttgtttatggggtgcaagtttctatgcgaacttctgctttgcttcaagcg
ggccaaaaagcgcgtttgaaaatcttacaagtgattaaagaagatgcgcatcttctatat
gggtttttagaagagagcgaaaaaatcctctttgaaaggcttttaaaaatcaatggggta
ggggggcgtatcgctttagccattctttcaagcttttcaccgaatgaatttgaaaacatt
atcgccactaaagaagtcaaaaggctccagcaagtcccaggcataggcaaaaagctcgct
gataagatcatggtggatttgattggttttttcattcaagatgaaactagccctacgcgc
aatgaagtctttttagccctagagagtttgggctttaaaagcgctgaaatcaataaagtt
ttaaaaaccctaaaaccccatctcagcaccgaagtagcgattaaagaagccttacaacaa
ctgcgctcttaa

DBGET integrated database retrieval system