KEGG   Helicobacter pylori F32: HPF32_0473Help
Entry
HPF32_0473        CDS       T01911                                 

Gene name
hpaA-2
Definition
(GenBank) adhesion HpaA homologue HpaA2
  KO
K15846  neuraminyllactose-binding hemagglutinin
Organism
heq  Helicobacter pylori F32
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NLBH
Motif
Other DBs
NCBI-ProteinID: BAJ58055
UniProt: E6NNX9
Position
complement(506012..506854)
Genome map
AA seq 280 aa AA seqDB search
MNCFFFKRLFFSQRLCFKTLIALGLSSVLVGCAIKPVAEVKPQNQQEKPIQINEKIQTTQ
KVTPFNFNYSLHVAQAPQNYRLIGILAPRIQVSDNLKPYIDKFQDALINQIQTIFEKRGY
QTLFFKDESALTLQDKRKLFAVLDVKGWVGVLEDLKMNLKDPNNPNLGTLVDQSSGSVWF
SFYEPESNRVVHDFAVEVGTFQAITYTYKQSNSGGFNSSNSIIHEDLEKNKEDAIHQILN
KIYALIMKKAVTELTEKNISQYKEAIDRMKGFKSSMPQKK
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaattgtttcttttttaagcgtttatttttttctcaaagactttgttttaaaacgcta
atcgctttggggctttcaagcgtgttggttggctgcgcgattaaaccagttgctgaagta
aaaccccaaaaccaacaagaaaaacccattcaaattaatgaaaaaatccaaaccactcaa
aaagtaacgccatttaattttaactactctttgcatgtcgcccaagccccacaaaattat
cgtttgatcggtattttagcgccacgcattcaagtgagcgataatctaaaaccctatatt
gataagtttcaagacgctttaatcaatcaaatccaaactatttttgaaaaaagaggctat
caaacgctcttttttaaagatgaaagcgctttaactttacaggataaaagaaagcttttt
gctgttttagatgtgaaagggtgggtgggcgttttagaagatttgaaaatgaatttaaaa
gatcccaataatcctaatttaggcacgctagtggatcaaagctcaggctctgtgtggttt
agtttttatgagccagaaagcaatcgtgtagtccatgattttgctgtggaagtgggaact
tttcaggcaataacctatacttacaaacagagtaattctggagggtttaattcttcaaac
agcattatccatgaagatttagaaaagaataaagaagatgccatccatcagattttaaac
aaaatatacgctttaatcatgaaaaaagccgtaacggaattgacagaaaaaaatatttct
caatacaaagaggcgattgatagaatgaaagggtttaaaagttctatgcctcaaaaaaag
tag

DBGET integrated database retrieval system