KEGG   Helicobacter pylori F32: HPF32_0477Help
Entry
HPF32_0477        CDS       T01911                                 

Gene name
ybgC
Definition
(GenBank) hypothetical protein
  KO
K07107  acyl-CoA thioester hydrolase [EC:3.1.2.-]
Organism
heq  Helicobacter pylori F32
Brite
KEGG Orthology (KO) [BR:heq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HPF32_0477 (ybgC)
Enzymes [BR:heq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.-  
     HPF32_0477 (ybgC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 4HBT 4HBT_2
Motif
Other DBs
NCBI-ProteinID: BAJ58059
UniProt: E6NNY3
Structure
PDB: 

Position
complement(509558..509959)
Genome map
AA seq 133 aa AA seqDB search
MRCRVYYEDTDSEGVVYHANYLKYCERARSEFFFKQNVLPENEEGVFVIRSIKADFFTPA
SLGQVLEIRTQIKELRKVFVVLFQEIYCIQNASLEPMKPFKVFASEIKFGFVNRSTYSPI
AIPKLFKELFNAI
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgcgctgtagggtatattacgaagataccgactctgaaggcgtggtctatcatgcgaat
tatttgaaatattgcgaaagggctagaagcgagtttttttttaaacaaaatgtcttgcca
gaaaatgaagaaggcgtgtttgttatccgctctatcaaagcggattttttcacccccgca
agccttgggcaggtcttagaaataagaacgcaaattaaagaattaagaaaggtttttgtg
gtgctttttcaagaaatttattgcatccaaaacgcttctttagagcctatgaagcctttt
aaagtctttgcttcagaaatcaagtttggctttgtcaatcgctctacatacagccctatt
gccattcctaaattgtttaaggagctgttcaatgccatctga

DBGET integrated database retrieval system