KEGG   Helicobacter pylori F32: HPF32_0482Help
Entry
HPF32_0482        CDS       T01911                                 

Gene name
dnaN
Definition
(GenBank) DNA polymerase III subunit beta
  KO
K02338  DNA polymerase III subunit beta [EC:2.7.7.7]
Organism
heq  Helicobacter pylori F32
Pathway
heq00230  Purine metabolism
heq00240  Pyrimidine metabolism
heq01100  Metabolic pathways
heq03030  DNA replication
heq03430  Mismatch repair
heq03440  Homologous recombination
Module
heq_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:heq00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    HPF32_0482 (dnaN)
   00240 Pyrimidine metabolism
    HPF32_0482 (dnaN)
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    HPF32_0482 (dnaN)
   03430 Mismatch repair
    HPF32_0482 (dnaN)
   03440 Homologous recombination
    HPF32_0482 (dnaN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:heq03032]
    HPF32_0482 (dnaN)
   03400 DNA repair and recombination proteins [BR:heq03400]
    HPF32_0482 (dnaN)
Enzymes [BR:heq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     HPF32_0482 (dnaN)
DNA replication proteins [BR:heq03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     HPF32_0482 (dnaN)
DNA repair and recombination proteins [BR:heq03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     HPF32_0482 (dnaN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_beta DNA_pol3_beta_3 DNA_pol3_beta_2 AbiEi_3
Motif
Other DBs
NCBI-ProteinID: BAJ58064
UniProt: E6NNY8
Structure
PDB: 

Position
514004..515128
Genome map
AA seq 374 aa AA seqDB search
MKISVSKNDLENTLRYLQAFLDKKDASSIASHIHLEVIKEKLFLKASDSDIGLKSYIFTQ
SSDKEGVGTINGKKFLDIISCLKDSNIILETKDDSLVIKQNKSSFKLPMFDADEFPEFPV
IEPKVSLEVNAPFLTDAFKKIAPVIEQTSHKRELAGILMQFDQKDQTLSVVGTDTKRLSY
TQLEKISIHSTEEDISCILPKRALLEILKLFYENFSFKSDGMLAVIENETHTFFTKLIDG
NYPDYQKILPKEYLSSFTLGKEEFKESIKLCSSLSSTIKLTLEKNNALFESLDSEHSETA
KTSVEIEKGLDIEKAFHLGVNAKFFLEALNALGTTQFVLKCNEPSSPFLIQEPLDEKQNH
LNAKISTLMMPITL
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcagtgttagtaaaaacgatttagaaaatactttgcgctacttgcaagctttt
ttggataaaaaggacgcttcttctatcgcttcacacatccatttagaagtcattaaagaa
aagctttttttgaaagccagcgattcagatattgggctaaaaagctatatttttacgcaa
tctagcgataaagagggcgttggcacgatcaacgggaaaaagtttttggatattatctca
tgtttaaaagactctaatattattttagagactaaagatgacagcttggtgatcaaacaa
aataaaagctctttcaaactccccatgtttgacgctgatgagttccctgaattccctgtt
attgagccaaaagtgagtttggaagtcaatgccccctttttaacagatgcgtttaaaaag
atcgctcctgtgattgagcaaaccagccataaaagggaattagccggtattttaatgcaa
tttgatcaaaaagatcaaaccctttcagtggtaggcacggataccaaacggctctcttac
acgcagttagaaaaaatctctatccattccactgaagaagacatctcttgcattttacct
aaaagagctttattagaaatccttaagcttttttatgaaaatttcagttttaaaagcgat
ggcatgttagcggtaattgaaaacgaaacgcacacttttttcaccaagctcattgatggg
aattaccctgattatcaaaaaatcctccctaaagaatacctttcttctttcactttaggc
aaggaagaatttaaagagagcattaaattgtgcagttctttaagctccactattaaactc
actttagaaaaaaacaacgctttgtttgaatctttggattctgagcatagcgaaacggct
aaaacctctgttgagattgaaaaaggtttggatattgaaaaagcctttcatttgggcgtg
aacgctaaatttttccttgaagccttaaacgctttagggacaacgcaatttgttttaaaa
tgcaatgagccttcttcgccttttttgatccaagagcctcttgatgaaaagcaaaaccac
ttgaacgctaaaatttccactttgatgatgccaatcacattataa

DBGET integrated database retrieval system