KEGG   Helicobacter pylori F32: HPF32_0484Help
Entry
HPF32_0484        CDS       T01911                                 

Definition
(GenBank) Type II modification enzyme
Organism
heq  Helicobacter pylori F32
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Eco57I
Motif
Other DBs
NCBI-ProteinID: BAJ58066
UniProt: E6NNZ0
Position
517469..518497
Genome map
AA seq 342 aa AA seqDB search
MINPKHLNKRESVNLGAYYTPPYLVDYAYKLLKKHVGIEDYTLLDTACGNKEFLKLHHPK
KIGADIDPKCDALIINALANPKRENYGISQDEPLIIVGNPPYNDRTSFIKQDIKNKDFIF
EIDNDLKSRDLGISFLRSFAILKPAFICVLHPLSYLIKEANFKQLKLFKDNYRLLDAFVV
SSKSFTKSNEFPIVIALYERGRMDYADIRRFIFPTDCDTTLCLNDFDYIANYVDKYPNAK
KVDACVGYFFPMRDINALKRNKTFLNAPSENAVRISQDKLIYYQYIHYFKEIAPKIPYYF
GNLDIIIENSAFLEIKDAFLKDKRVRLEYFKKLFQGHPCEFD
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
ttgattaaccctaaacatttaaataagcgagagagcgtgaatttaggggcttattacacg
cccccttatttagtggattatgcttacaagcttttaaaaaagcatgttggtattgaagac
tacacgcttttagacaccgcatgtggtaataaagagtttttaaagctccaccaccctaaa
aaaataggagcggatattgaccccaagtgtgatgctttaataataaacgctctagccaat
cctaaaagagaaaattatggtattagccaagatgagcctttaatcatcgtgggcaatccc
ccctataacgatagaacttcctttatcaaacaagatattaaaaataaagatttcattttt
gagatagacaacgatttgaagtctagggatttagggataagttttttaagatcttttgca
attttaaagccggcgtttatttgcgtgttacaccctttatcttatctcatcaaagaagct
aattttaagcaattaaagctatttaaggataattacaggcttttagacgcttttgttgtt
tcttctaaatctttcactaaaagtaacgaatttcctattgtgatagctttatatgagcga
gggcgaatggactatgcagatattaggcgttttatttttccaactgattgcgatacgacg
ctatgcttaaacgattttgactatatagccaattatgtggataaataccccaacgctaaa
aaggttgatgcatgcgtgggctattttttccccatgcgagacattaacgctcttaaacgc
aacaaaacttttttaaacgcaccaagcgaaaatgcggtgcgaatcagtcaagataaattg
atctattaccaatatatccattattttaaggaaatcgctcctaaaatcccttattatttt
ggtaatttggatattattattgaaaattccgcttttttagaaattaaagacgctttttta
aaagataaaagagtgcgtttagaatattttaaaaaattgtttcaaggacacccttgtgag
tttgattaa

DBGET integrated database retrieval system