KEGG   Helicobacter pylori F32: HPF32_0490Help
Entry
HPF32_0490        CDS       T01911                                 

Gene name
dapB
Definition
(GenBank) dihydrodipicolinate reductase
  KO
K00215  4-hydroxy-tetrahydrodipicolinate reductase [EC:1.17.1.8]
Organism
heq  Helicobacter pylori F32
Pathway
heq00261  Monobactam biosynthesis
heq00300  Lysine biosynthesis
heq01100  Metabolic pathways
heq01110  Biosynthesis of secondary metabolites
heq01120  Microbial metabolism in diverse environments
heq01130  Biosynthesis of antibiotics
heq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:heq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    HPF32_0490 (dapB)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    HPF32_0490 (dapB)
Enzymes [BR:heq01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.8  4-hydroxy-tetrahydrodipicolinate reductase
     HPF32_0490 (dapB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DapB_C DapB_N NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: BAJ58072
UniProt: E6NNZ6
Position
524010..524774
Genome map
AA seq 254 aa AA seqDB search
MKIGVYGASGRIGKLLLEELKGGYKGLELSSVFVRQKCETDFSSFSHAPLVTNDLKAFVR
ACECVIDFSLPKGVDNLLEALLECPKILVSGTTGLEKETLEKMQQLALKAPLLHAHNMSL
GIMMLNQLAFLASLKLKDADIEIVETHHNLKKDAPSGTALSLYETCAKARGYDEKNALTT
HREGLRSKESIGIAALRGGDVAGKHTIGFYLEGEYIELSHTATNRSIFAKGALEVALWLK
DKAAKKYEINEMFG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcggtgtttatggagcgagcggtcgtatagggaaactgcttttagaagaatta
aaaggggggtataagggattagagctatctagcgtgtttgtcaggcaaaaatgcgaaaca
gatttcagctctttttcgcacgcccctttagtaaccaatgatttaaaagcgtttgtgaga
gcttgcgaatgcgtgattgatttttctttacctaaaggcgtggataatttgctagaggct
cttttagaatgccctaaaattttagtttctggcacgaccggtttagaaaaagaaacgcta
gaaaaaatgcaacaattagccttaaaagcaccgcttttgcatgcgcacaacatgtcttta
gggatcatgatgctcaatcaattagcctttttagcttctttgaaattaaaagatgcggac
attgaaattgtagaaacgcaccacaatctcaaaaaagacgccccgagcggcactgcgttg
agtttgtatgaaacttgcgctaaggctagggggtatgatgaaaaaaacgctcttaccact
cacagagaaggtttgcgctctaaagaaagcattggcatagccgctttaagggggggcgat
gttgccgggaagcacacgatagggttttatttagagggcgaatacatagagcttagccat
acagcgactaaccgatctatttttgctaaaggggctttagaagtggctctatggcttaaa
gataaagccgctaaaaaatatgaaatcaacgagatgtttggctga

DBGET integrated database retrieval system