KEGG   Helicobacter pylori F32: HPF32_0494Help
Entry
HPF32_0494        CDS       T01911                                 

Gene name
rplI
Definition
(GenBank) 50S ribosomal protein L9
  KO
K02939  large subunit ribosomal protein L9
Organism
heq  Helicobacter pylori F32
Pathway
heq03010  Ribosome
Module
heq_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:heq00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    HPF32_0494 (rplI)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:heq03011]
    HPF32_0494 (rplI)
Ribosome [BR:heq03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    HPF32_0494 (rplI)
  Bacteria
    HPF32_0494 (rplI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L9_C Ribosomal_L9_N DUF4326
Motif
Other DBs
NCBI-ProteinID: BAJ58076
UniProt: E6NP00
Position
529335..529784
Genome map
AA seq 149 aa AA seqDB search
MKVLLLEDVKNLGKAGEVCEVKDGYGNNFLIANKKAKLATNEVINKYKAEVKKKAEKEAL
EKAQKLQMVETLQAITLTIHKKVGANGSLFGAITKEEITERLKEQHANLDLDKKDIELKH
PIKSTGIYEIEVKLGSGVVGAFKIDVVAE
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttctattactagaagatgtgaaaaatttgggcaaagcaggtgaagtgtgtgag
gttaaagacggctatgggaataactttttaatcgctaacaaaaaagctaaactcgccact
aacgaagtgatcaacaaatacaaagccgaagttaaaaagaaagctgaaaaagaagcccta
gaaaaggcacaaaaattacaaatggtagaaaccttacaagccatcacgctgactatccat
aaaaaagtcggcgcgaatggctctttatttggagcgatcactaaagaagagatcacagag
cgtttgaaagaacagcatgcgaatttggatttagataaaaaagacattgaactcaaacac
ccgattaaaagcacagggatttatgagattgaagtcaagcttggatctggggttgtgggc
gcgtttaaaattgatgtggtggctgagtag

DBGET integrated database retrieval system