KEGG   Helicobacter pylori F32: HPF32_0501Help
Entry
HPF32_0501        CDS       T01911                                 

Gene name
cag3
Definition
(GenBank) cag pathogenicity island protein
  KO
K12088  cag pathogenicity island protein 3
Organism
heq  Helicobacter pylori F32
Module
heq_M00564  Helicobacter pylori pathogenicity signature, cagA pathogenicity island
Brite
KEGG Orthology (KO) [BR:heq00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:heq02044]
    HPF32_0501 (cag3)
Secretion system [BR:heq02044]
 Type IV secretion system
  Cag pathogenicity island (PAI) protein
   HPF32_0501 (cag3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_C78 Cytadhesin_P30
Motif
Other DBs
NCBI-ProteinID: BAJ58083
UniProt: E6NP07
Position
535188..536633
Genome map
AA seq 481 aa AA seqDB search
MFRKLATAVSLIGLLTSNTLYTKEISEADRVIKATKETKETKKEAKRLKKEARQRQQIPD
HKKPQYVSVDDTKTQALFDIYDTLNVNDKSFGDWFGNSALKDKTYLYAMDLLDYNNYLSI
ENPIIKTRAMGTYADLIIITGSLEQVNGYYNILKALNKRNAKFVLKINENLPYAQATFLR
VPKRSDPNAHTLDKGASIDENKLFEQQKRAYFNYANDVICRPNDEVCSPLRDEMVAMPTS
DSATQKPNIIAPYSLYRLKETNNANEAQPSPYATQTAPENSKEKLIEELIANSQLIANEE
EREKKLLAEKEKQEAELAKYKLKDLENQKKLKALEAELKKKNAKKPRVVEVPISPRTSNS
FETMRVVKEKENYNGLLVDKETTIKRSYQGTLISENSYSKKTPLNPNDLRSLEEEIKSYY
IKSNGLCYANGISLYVKIKNDPYKEGMLCGYESIQNLLSPLKDKLKYDKQKLQKALLKDS
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgtttagaaaactagcaaccgctgtatcgctcataggcttactaacctctaacactctt
tatactaaagaaataagtgaagccgatagggtcattaaggccactaaagaaactaaagaa
accaagaaagaagctaaacgactcaaaaaagaagccagacaacgccaacagatccctgat
cataagaaacctcaatatgtttctgttgatgacacaaaaactcaagcgctttttgatata
tacgacaccttgaatgtgaatgacaaaagctttggggattggtttggtaatagcgctttg
aaagacaaaacctatctctacgctatggatctattggattacaacaactatctatccata
gaaaaccccattatcaaaacaagagcaatgggaacctatgcggatctcatcatcatcaca
ggctcactagaacaagtcaatgggtattacaacattctaaaagcgctcaacaaacgaaac
gctaagtttgtcttaaaaatcaatgaaaacctgccttacgcccaagcgacttttttgaga
gtgccaaaaagaagcgatcccaatgcccatacgcttgataagggagcgtcaattgatgag
aataagctttttgaacaacaaaaacgcgcgtatttcaactacgccaacgatgtgatctgc
agacccaatgatgaagtgtgttcgcccctaagagatgaaatggtagctatgcccactagc
gatagcgctactcaaaaacctaatatcattgctccttatagtttgtatagactaaaagag
acaaataacgccaatgaggctcaaccatcaccttatgccactcaaaccgctcctgaaaac
agcaaagagaagctcatagaagagctaatcgctaactcccaactcatagccaatgaagaa
gagagggaaaagaaactcttagcagaaaaagaaaaacaagaggctgaattggctaaatac
aagctcaaagacctagaaaatcaaaagaaactaaaagctttagaagcagagttgaaaaag
aaaaatgctaagaaacctagagtggtggaagtgcctatttctcctagaacaagtaattct
tttgaaacaatgagagttgtcaaagaaaaagaaaactataatggattgttagtggataaa
gaaaccacgatcaaacgaagctatcaagggactttgatcagtgaaaattcttacagcaaa
aaaacacctctcaaccctaatgacttgagaagcttagaagaagaaattaagagctactat
attaagtctaatggcttgtgttatgctaatggcattagtctctatgtcaaaatcaaaaac
gacccctataaagagggaatgctgtgtggctatgaaagtattcaaaatctgctctcacct
ctaaaggataagctcaagtacgacaagcaaaaattacaaaaagcgttactgaaagattca
aagtaa

DBGET integrated database retrieval system