KEGG   Helicobacter pylori F32: HPF32_0502Help
Entry
HPF32_0502        CDS       T01911                                 

Gene name
cag4
Definition
(GenBank) cag island protein
  KO
K12089  cag pathogenicity island protein 4
Organism
heq  Helicobacter pylori F32
Module
heq_M00564  Helicobacter pylori pathogenicity signature, cagA pathogenicity island
Brite
Secretion system [BR:heq02044]
 Type IV secretion system
  Cag pathogenicity island (PAI) protein
   HPF32_0502 (cag4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SLT DUF4322 A2M_comp HAP2-GCS1
Motif
Other DBs
NCBI-ProteinID: BAJ58084
UniProt: E6NP08
Position
536643..537152
Genome map
AA seq 169 aa AA seqDB search
MFEKWIGLFLLLGSLAYSCQKVTISFKQYENLIHIHQKGCDNEVVCRTLISIALLESSLG
LNNKREISLKDTSYSMFHITLNTAKKFYPTYSKTLLKYKLLNDVDFAIGLAKRILKENFD
YYKQKHPNKSMYQIVEMAVGAYNGGMKHNPNGAYVKKFRCIYSQVHYNE
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
ttgtttgagaaatggattggtctctttctacttcttggttctttagcctattcatgccaa
aaggtaaccattagtttcaagcagtatgagaatcttatccatatccaccaaaaaggttgc
gacaatgaagtggtgtgcagaacgctcatctctatcgctttattggaaagttctttaggg
ttgaacaacaagcgcgaaatttccctaaaagacacttcctattccatgtttcacatcact
ttgaacaccgctaaaaaattctaccccacctattctaaaacgctcctcaaatacaaattg
ctcaatgatgtggattttgcgattgggttggctaaaagaattttgaaagaaaattttgat
tattacaaacaaaaacaccctaataaaagcatgtatcaaatagtagaaatggcagtaggc
gcttacaatggaggaatgaaacacaaccctaatggcgcttatgtgaaaaagttccgctgc
atttattctcaggtgcactacaacgagtag

DBGET integrated database retrieval system