KEGG   Helicobacter pylori F32: HPF32_0504Help
Entry
HPF32_0504        CDS       T01911                                 

Gene name
virB11-2
Definition
(GenBank) cag pathogenicity island protein
  KO
K03196  type IV secretion system protein VirB11
Organism
heq  Helicobacter pylori F32
Pathway
heq03070  Bacterial secretion system
Module
heq_M00564  Helicobacter pylori pathogenicity signature, cagA pathogenicity island
Brite
KEGG Orthology (KO) [BR:heq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    HPF32_0504 (virB11-2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:heq02044]
    HPF32_0504 (virB11-2)
Secretion system [BR:heq02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein [MD:M00333]
   HPF32_0504 (virB11-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T2SSE ABC_tran DEAD FtsK_SpoIIIE ATP_bind_1 AAA_19 ResIII Mg_chelatase Pox_A32 AAA_32 IPPT AAA_22 TrwB_AAD_bind Zeta_toxin DUF87 AAA_16 AAA_30 GARS_A Septin HATPase_c_2 AAA_29 AAA_33
Motif
Other DBs
NCBI-ProteinID: BAJ58086
UniProt: E6NP10
Structure
PDB: 

Position
complement(539712..540704)
Genome map
AA seq 330 aa AA seqDB search
MTEDRLSAEDKKFLEVERALKEAALNPLRHATEELFGDFLKMENITEICYNGNKVVWVLK
NNGEWQPFDVRDKKAFSLSRLMHFARCCASFKKKTIDNYENPILSSNLANGERVQIVLSP
VTVNDETISISIRIPSKTTYPHSFFEEQGFYNLLDNKEQAISAIKDGIAIGKNVIVCGGT
GSGKTTYIKSIMEFIPKEERIISIEDTEEIVFKHHKNYTQLFFGGNITSADCLKSCLRMR
PDRIILGELRSSEAYDFYNVLCSGHKGTLTTLHAGSSEEAFIRLANMSSSNNAARNIKFE
SLIEGFKDLIDMIVHINHHKQCDEFYIKHR
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagacagattgagtgcagaagataaaaaatttctagaagtagaaagagcttta
aaagaagcggcattaaatcctctaaggcatgctactgaagagctttttggtgatttttta
aaaatggaaaatatcactgagatttgttacaatgggaacaaggttgtatgggttttaaaa
aataatggcgaatggcaaccatttgatgtgagagacaagaaagcctttagtttatctcgt
ttaatgcattttgctcggtgctgtgcaagttttaagaaaaaaacaatagacaactatgaa
aatcctattttaagcagcaatttagcgaatggtgaaagggtgcagattgtcctttcccct
gttacagttaatgatgaaaccatttccatatccataaggatacctagcaaaacaacctat
cctcatagcttctttgaagaacagggtttttataatctgctagataacaaagaacaagcg
atcagcgcgattaaagatggtattgctattggtaagaatgtgattgtttgtggtggcaca
ggaagcggtaaaacgacttatatcaaaagcatcatggagtttatccctaaagaagaaagg
atcatatccattgaagacaccgaagagattgtattcaaacaccacaagaactacacacag
cttttttttggtgggaatatcacctctgctgattgtttaaagtcatgtttgagaatgcga
cctgatagaatcattttaggagaactcagaagcagtgaggcatatgatttttataatgtg
ctttgtagcggtcataaaggcacgctaaccactctacatgcagggagcagtgaagaagcg
tttatccgtttagccaacatgagttcatctaataacgcagcaaggaatatcaagtttgaa
agcctcattgagggctttaaagatttaattgatatgattgtccatatcaaccaccacaaa
cagtgtgatgaattttatatcaaacataggtag

DBGET integrated database retrieval system