KEGG   Helicobacter pylori F32: HPF32_0508Help
Entry
HPF32_0508        CDS       T01911                                 

Gene name
cagW
Definition
(GenBank) cag pathogenicity island protein
  KO
K12094  cag pathogenicity island protein 9
Organism
heq  Helicobacter pylori F32
Module
heq_M00564  Helicobacter pylori pathogenicity signature, cagA pathogenicity island
Brite
KEGG Orthology (KO) [BR:heq00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:heq02044]
    HPF32_0508 (cagW)
Secretion system [BR:heq02044]
 Type IV secretion system
  Cag pathogenicity island (PAI) protein
   HPF32_0508 (cagW)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: BAJ58090
UniProt: E6NP14
Position
complement(549086..550693)
Genome map
AA seq 535 aa AA seqDB search
MFNIKRTFLITIMSFFLIVPNWLKAIDLPIVSNLKIYQTVYCMLIPSYVLTNKSFADILT
GYTSIGASGSGKSSGQGVIEALSTPLATSLAASNLVKYLNTLGPLWGSAWASVATAIQGF
ALTPSSGCNFGWNALINKNIDVSMDSMLDNLSNKIQNFTKGGVEDNVKGNVLLQIISSIT
AQASTNITADGLIWLIGKEFTANKLQNNATAMLAFAALESVVKGADAAVLPAYGVVNLPD
IIIGQGSYLDFVSYLIYIVFGIFVFISFMKLRDISNGIQINIGFEYMRFVGGTLFKMAMV
SFIAYAGFGYLYKISYSIYFGLAGAFGLNQVLFWALDLVLNYTVNSILPAVRAVFSNVGN
NAPSLLQGLQVAGISLFAIFMQVTIIMRISTVVVKPLIAGAFSGIVFPIAVCLIVLDWFK
DSMKNILIWFINNLFILVLAIPILLFGVLALLAFNLTITPSVAIQNINQGGLGIDSTIAS
LITLFILKGFIETIIESVNAIVNTIFSSVSMDGSRMDRERDALMVGRVGGSMFKG
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgtttaatattaaaaggacttttttaataacgatcatgagtttttttctcattgttcct
aattggttgaaagctattgatttgcccattgtttcaaatctcaaaatttaccaaacagtt
tattgcatgctgataccgagttatgttttaaccaacaaaagttttgcagatattttgaca
ggctatacatctattggtgcatcagggagtggaaagagttcagggcagggtgtgattgaa
gcgcttagcacaccattagccacaagtttagccgctagcaatctggtgaaatatttgaat
actttaggtcctttatggggatcggcgtgggcaagtgttgctacagctatacaaggtttt
gctctaacgccatcaagtggctgtaattttggttggaacgcattgataaataaaaacata
gatgtatccatggatagcatgctagacaatttgagcaacaagattcagaattttaccaaa
ggcggtgttgaggacaatgtgaaaggcaatgttcttctacaaataattagctcaataacc
gctcaagcttctacgaatattacagctgatggtttaatttggctgattggcaaagaattc
actgcaaataaactgcaaaacaacgctacagccatgcttgcttttgccgctctggaatct
gttgtcaaaggagcggatgctgctgttcttcctgcatatggtgtagtcaatctacctgat
attatcatagggcaagggtcatatcttgattttgtttcttacctaatttatattgttttt
gggatttttgtttttatttctttcatgaaattgagagatatttcaaatggcattcagatt
aacataggttttgaatacatgcgatttgttggggggacattattcaaaatggcgatggtt
tcttttatcgcctatgcaggttttggttatctttataaaatctcttattccatttatttt
ggtttagcaggtgcttttgggttgaatcaagttcttttttgggctttagatttagtgctg
aattacactgttaattcaattttacctgcggtaagagctgttttttctaatgttggcaat
aacgctcctagtttgttacaaggcttgcaagtggcaggtatttctttattcgctattttt
atgcaagtaactatcattatgagaataagcactgttgttgtgaaacctttgatagcgggg
gcttttagcggtattgtgttccctattgcggtgtgtttgatcgtgctagattggttcaaa
gattctatgaaaaacatattgatatggtttattaataatttgtttatcttggttctagct
attcctattttgctctttggtgttttggcattattggcattcaatttgaccataacgccc
tctgttgctatacaaaacatcaatcaagggggactaggtatcgattcaactattgcgagt
ttgatcactctatttattttaaaaggtttcatagagacgattattgagagtgtcaatgcg
atcgttaacaccattttcagctctgtatctatggatggtagcagaatggatagagaaaga
gatgccttaatggtgggaagagttggtggatctatgtttaaaggataa

DBGET integrated database retrieval system