KEGG   Helicobacter pylori F32: HPF32_0515Help
Entry
HPF32_0515        CDS       T01911                                 

Gene name
cagL
Definition
(GenBank) cag pathogenicity island protein
  KO
K12103  cag pathogenicity island protein 18
Organism
heq  Helicobacter pylori F32
Module
heq_M00564  Helicobacter pylori pathogenicity signature, cagA pathogenicity island
Brite
Secretion system [BR:heq02044]
 Type IV secretion system
  Cag pathogenicity island (PAI) protein
   HPF32_0515 (cagL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: BAJ58097
UniProt: E6NP21
Structure
PDB: 

Position
complement(558202..558915)
Genome map
AA seq 237 aa AA seqDB search
MKTLVKNTISSFLLLSVLMAEDITSGLKQLDNTYKETNQQVLKNLDEIFSTTSPSANNEI
GQEDALNIKKAAIALRGDLALLKANFEANELFFISEDVIFKTYMSSPELLLTYMKINPLD
QNTAEQQCGISDKVLVLYCEGKLKIEQEKQNIRERLETSLKAYQSNIGGTASLITASQTL
VESLKNKNFIKGIRKLMLAHDKVFLNYLEKLDALEISLEQSKRQYLQERQSSKVIVK
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacactcgtgaaaaataccatatcttcttttttgctcttgtctgttttgatggca
gaagatataacaagcggcttaaagcaacttgataacacctacaaagagaccaaccaacaa
gtgctcaaaaacctagatgagattttttcaaccactagccctagcgctaataatgaaata
ggtcaagaagatgctctaaacatcaaaaaagcggccattgctttgaggggagatttagcg
ttattgaaagccaattttgaagcgaatgagttatttttcatctcagaagatgtgattttc
aagacttatatgtctagccctgaacttttattaacctatatgaaaatcaatcccttagac
caaaacactgctgaacaacaatgcggaatatccgataaagttttagttctttattgtgag
gggaagctgaaaatcgagcaagaaaaacaaaatataagagagcgtttagaaacttctcta
aaggcgtatcagagtaacattggaggtacagcttccttaatcactgcttcacagacgctt
gtagaaagcctaaagaataaaaatttcattaaaggaatcagaaagctcatgttagctcac
gacaaggtctttttaaattatttagagaagttggacgcattagaaatatccctagaacaa
agcaagcggcaatacctacaagaaaggcaatcaagtaaggttattgttaaatga

DBGET integrated database retrieval system