KEGG   Helicobacter pylori F32: HPF32_0523Help
Entry
HPF32_0523        CDS       T01911                                 

Gene name
cagA
Definition
(GenBank) cag pathogenicity island protein
  KO
K15842  cytotoxicity-associated immunodominant antigen
Organism
heq  Helicobacter pylori F32
Module
heq_M00564  Helicobacter pylori pathogenicity signature, cagA pathogenicity island
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CagA
Motif
Other DBs
NCBI-ProteinID: BAJ58105
UniProt: E6NP29
Position
567055..570576
Genome map
AA seq 1173 aa AA seqDB search
MTNETIDQTTTPDQTGFVPQRFINNLQVAFIKVDNAVASFDPDQKPIVDKNDKDNRQAFE
KISQLREEYANKAIKNPAKKNQYFSDFINKSNDLINKDNLIAVDSSVESFRKFGDQRYQI
FTSWVSLQKDPSKINTQQIRNFMENVIQPPISDDKEKAEFLRSAKQSFAGIIIGNQIRSD
EKFMGVFDESLKARQEAEKNAEPAGGDWLDIFLSFVFNKKQSSDLKETLNQEPRPDFEQN
LATTTTDIQGLPPEARDLLDERGNFFKFTLGDVEMLDVEGVADKDPNYKFNQLLIHNNAL
SSMLMGSHSNIEPEKVSLLYGDNGGPEARHDWNATVGYKNQQGNNVATLINAHLNNGSGL
IIAGNEDGIKNPSFYLYKEDQLTGLKQALSQEEIQNKVDFMEFLAQNNAKLDNLSEKEKE
KFQTEIENFQKDRKAYLDALGNDHIAFVSKKDPKHLALVTEFGNGELSYTLKDYGKKQDK
ALDGETKTTLQGSLKYDGVMFVNYSNFKYTNASKSPNKGLGTTNGVSHLEANFSKVAVFN
LPNLNNLAITNYIRRDLEDKLWAKGLSPQEANKLIKDFLNSNKEMVGKVSNFNKAVAEAK
NTGNYDEVKKAQKDLEKSLRKREHLEKEVAKKLESRNDNKNRMEAKAQANSQKDKIFALI
SQEASKEARVATFDPNLKGVRSELSDKLENINKNLKDFGKSFDELKSGKNNDFSKAEETL
KALKDSVKDLGINPEWISKIENLNAALNDFKNGKNKDFSKVTQAKSDLENSIKDVIINQK
ITDKVDNLNQAVSEIKLTGDFSKVEQALAELKNLSLDLGKNSDLQKSVKNGVNGTLVSNG
LSKTEATTLTKNFSDIRKELNEKLFGNSNNNNNGLKNNTEPIYAQVNKKKTGQATSPEEP
IYAQVAKKVSAKIDQLNEATSAINRKIDRINKIASAGKGVGGFSGAGRSASPEPIYATID
FDEANQAGFPLRRSAAVNDLSKVGLSREQELTRRIGDLSQAVSEAKTGHFGNLEQKIDEL
KDSTKKNALKLWVESAKQVPTSLQAKLDNYATNSHTRINSNVQSGTINEKATGMLTQKNP
EWLKLVNDKIVAHNVGSAPLSAYDKIGFNQKNMKDYSDSFKFSTKLNNAVKDIKSSFVQF
LTNTFSTGSYSLMKANVEHGVKNTNTKGGFQKS
NT seq 3522 nt NT seq  +upstreamnt  +downstreamnt
atgactaacgaaaccattgatcaaacaacaacaccagaccaaacgggttttgttccgcaa
cgatttatcaataatcttcaagtagcttttatcaaagttgataacgctgtcgcttcattt
gatcctgatcaaaaaccaatcgttgataagaatgataaggataacaggcaagcttttgag
aaaatctcgcaactaagggaagaatacgccaataaagcgatcaaaaatcctgccaaaaag
aatcagtatttttcagactttatcaataagagcaatgatttgatcaacaaagacaatctc
attgctgtagattcttccgtagagagctttcggaaatttggggatcagcgttaccaaatt
tttacgagttgggtgtcccttcaaaaagatccgtctaaaatcaacacccaacaaatccga
aattttatggaaaatgtcatacaaccccctatctctgatgataaagaaaaagcggagttt
ttgaggtctgccaaacaatcttttgcaggaattatcatagggaaccaaatccgatcggat
gaaaaattcatgggcgtgtttgatgaatctttgaaagcaaggcaagaagcagaaaaaaat
gcagagcctgctggtggggattggcttgatatttttttatcatttgtatttaacaaaaaa
caatcttccgatctcaaagaaacgctcaatcaagagccaaggcctgattttgaacaaaat
ttagccactaccaccaccgacatacaaggcttaccgcctgaagctagagatttgcttgat
gaaaggggtaatttttttaaattcactcttggtgatgtggagatgttggatgttgaggga
gtcgctgacaaggatcccaattacaagttcaatcaattattgatccacaataacgcttta
tcttctatgctaatggggagtcatagtaacatagaacctgaaaaggtttcattattgtat
ggggataatggtggccctgaagctaggcatgattggaacgctaccgttggttataaaaac
caacaaggcaacaatgtggccacactcattaatgcgcatcttaataacggcagcgggtta
atcatagcgggtaatgaggatgggattaaaaaccctagcttctatctctataaagaagat
caactcacaggtttgaaacaagcgttgagtcaagaagagatccaaaacaaagtggatttc
atggaatttctcgcacaaaacaatgctaaattagacaacttgagcgagaaagagaaagaa
aaattccaaactgagattgaaaatttccaaaaagaccgtaaggcttatttggacgctcta
gggaatgatcacattgcttttgtttctaaaaaagacccaaaacatttagctttggttact
gagtttggtaatggggaattgagctatactctcaaagattatgggaaaaaacaagataaa
gctttagatggggagacaaaaaccactcttcaaggtagcctaaaatatgatggcgtgatg
tttgtcaattattctaatttcaaatacaccaacgcctccaagagtcctaataagggttta
ggcactacgaatggcgtttcccatttggaagcgaattttagcaaagtagctgtctttaat
ttgcctaatttaaataatctcgctatcactaattatataaggcgagatttagaagataaa
ctgtgggctaaaggattgtccccacaagaagctaataagctcatcaaagactttttaaac
agcaacaaagaaatggttggaaaagtttcaaacttcaataaagctgtagctgaagctaaa
aacacaggcaattatgatgaagtgaaaaaagctcagaaagatcttgaaaaatctctaagg
aaacgagagcatttagagaaagaagtagcgaaaaaattggagagcagaaacgacaacaaa
aatagaatggaagcaaaagctcaagctaacagccaaaaagataagatttttgcacttatc
agtcaagaggctagtaaggaagcaagagtggccactttcgatccgaatcttaaaggcgtc
aggagcgaattgtctgataaacttgaaaatatcaacaagaatttgaaagactttggcaaa
tcttttgatgaactcaaaagtggcaaaaataatgatttcagcaaggcagaagaaacgcta
aaagcccttaaagactcggtgaaagatttaggcatcaatccagaatggatttcaaaaatt
gaaaaccttaatgcagctttgaatgatttcaaaaatggcaaaaataaggatttcagcaag
gtaacacaagcaaaaagcgaccttgaaaattccattaaggatgtgatcattaatcaaaag
ataacggataaagttgacaatctcaatcaggctgtatcagagattaaattaacaggcgat
ttcagtaaggtagagcaagccctagccgaactcaaaaacttgtcattggatcttggaaaa
aattctgatctacaaaaatccgttaaaaatggtgtaaatggaaccctagtcagtaatggg
ttgtctaaaacagaagccacaacgctcaccaaaaatttttcggacatcaggaaagaattg
aacgagaaattatttggaaattccaataacaataataatggactcaaaaacaacacagag
cctatttatgctcaagttaataaaaagaaaacaggacaagcaactagccctgaagagccc
atttacgctcaagttgctaaaaaggtgagtgcaaaaattgaccaactcaacgaagctaca
tcagcaataaatagaaaaattgaccggattaacaaaattgcatcagcaggtaaaggagtg
ggcggtttcagtggagcagggcgatcagctagccctgaacccatttacgctacaattgat
tttgatgaggcaaatcaagcaggcttccctttgagaagaagtgctgcagttaatgatctc
agtaaagtagggctttcaagggaacaagaattgactcgtagaattggcgatctcagtcag
gcagtgtcagaagctaaaacaggtcattttggcaacctagaacaaaagatagatgaactc
aaagattctacaaaaaagaatgctttgaagctatgggttgaaagtgcgaaacaagtgcct
actagtttgcaagcgaaattggacaattacgctactaacagccacacacgcattaatagc
aatgtccaaagtggaacaatcaatgaaaaagcgaccggcatgctaacgcaaaaaaaccct
gagtggctcaagctcgtgaatgataagatagttgcgcataatgtgggaagtgctcctttg
tcagcgtatgataaaattggattcaaccaaaagaatatgaaagattattctgactcgttc
aagttttccaccaagttgaacaatgccgtaaaagacattaagtctagctttgtgcaattt
ttaaccaatacattttctacaggatcttacagcttgatgaaagcaaatgtggaacatgga
gtcaaaaatactaatacaaaaggtggtttccaaaaatcttaa

DBGET integrated database retrieval system