KEGG   Helicobacter pylori F32: HPF32_0634Help
Entry
HPF32_0634        CDS       T01911                                 

Gene name
thl
Definition
(GenBank) acetyl coenzyme A acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
heq  Helicobacter pylori F32
Pathway
heq00071  Fatty acid degradation
heq00072  Synthesis and degradation of ketone bodies
heq00280  Valine, leucine and isoleucine degradation
heq00310  Lysine degradation
heq00362  Benzoate degradation
heq00380  Tryptophan metabolism
heq00620  Pyruvate metabolism
heq00630  Glyoxylate and dicarboxylate metabolism
heq00640  Propanoate metabolism
heq00650  Butanoate metabolism
heq00900  Terpenoid backbone biosynthesis
heq01100  Metabolic pathways
heq01110  Biosynthesis of secondary metabolites
heq01120  Microbial metabolism in diverse environments
heq01130  Biosynthesis of antibiotics
heq01200  Carbon metabolism
heq01212  Fatty acid metabolism
heq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:heq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPF32_0634 (thl)
   00630 Glyoxylate and dicarboxylate metabolism
    HPF32_0634 (thl)
   00640 Propanoate metabolism
    HPF32_0634 (thl)
   00650 Butanoate metabolism
    HPF32_0634 (thl)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HPF32_0634 (thl)
   00072 Synthesis and degradation of ketone bodies
    HPF32_0634 (thl)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HPF32_0634 (thl)
   00310 Lysine degradation
    HPF32_0634 (thl)
   00380 Tryptophan metabolism
    HPF32_0634 (thl)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPF32_0634 (thl)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HPF32_0634 (thl)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HPF32_0634 (thl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:heq04147]
    HPF32_0634 (thl)
Enzymes [BR:heq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HPF32_0634 (thl)
Exosome [BR:heq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPF32_0634 (thl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: BAJ58216
UniProt: E6NPE0
Position
complement(692789..693964)
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAVGSFLGSLKSVGTREMGAVVLKDALNASGLKPSDVDSVILGNVLSAG
LGQNIARQIQLDAGIPNDRNAFSVNMVCGSSMKAIQLAHDAIMLGHGEVVVCGGVENMSA
APYLSFDMRDGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNVAQAYHISREEQDTFAL
QSQLKARAAINAGKFQEEITPIEIANKKGVVVFKEDEYPRETTLESLAKLKPAFKKDGSV
TAGNSSGINDGASIIILCSAQKAQKLGLKTMATIKGFGLGGCSPDIMGICPSIAIKNNLK
NVKMNLNDINLFELNEAFAAQSIAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSAHSVGCASLCVGGGQGLSVIVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtggcggcaaaacgaagcgctgtggggagttttttaggctct
ctaaagagcgtgggcactagagaaatgggtgctgtcgtgcttaaagacgctctgaatgcg
agcggtcttaagcctagcgatgtggattctgtcattttaggcaatgttttatccgccggt
ttgggtcaaaatatcgccagacagatccaattggatgcgggcataccgaatgacaggaac
gcttttagcgtcaatatggtttgtggatcgtctatgaaagccattcaattagcgcatgat
gccatcatgcttgggcatggtgaggtggtggtgtgcggtggcgtggaaaacatgagtgca
gcaccttatctgtcgtttgacatgcgagatgggaaaagaatggggaatgcgaacatgata
gactccatgatccatgatggattgtgggatgcgttcaatgattaccacatggggatcacc
gctgataatgtcgctcaagcataccacatcagccgagaagagcaagatactttcgcgctc
caatcgcaactcaaagcaagagccgccattaatgcagggaaatttcaagaagagatcacg
cccattgaaatagcgaataaaaaaggcgtggttgtttttaaagaagacgaataccctaga
gaaacgacgctagaatcccttgcaaagctcaaacccgctttcaaaaaagacggatcggta
acggcaggaaattcatcagggatcaatgatggcgcgagtattatcattttatgcagcgct
caaaaagcgcaaaaattggggttaaaaacaatggcaactatcaaggggtttggtttgggt
ggttgcagtccagatataatggggatatgccctagcatcgctattaaaaacaatcttaaa
aatgtcaaaatgaatctcaatgacatcaatctttttgaactcaatgaagctttcgccgca
caaagcatagccgtattaaaagagcttgaattaaaccccaatatcgtgaatgtgaatgga
ggtgcgatagccattggccaccctattggtgcaagcggcgctaggatcttagtaacttta
ttgcatgaaatgaaaagaagcgctcatagcgtgggctgtgcgtcattgtgtgtgggcggc
ggacaagggctatcagtaatagtggaacaaaaataa

DBGET integrated database retrieval system