KEGG   Helicobacter pylori F32: HPF32_0984Help
Entry
HPF32_0984        CDS       T01911                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
heq  Helicobacter pylori F32
Pathway
heq00230  Purine metabolism
heq01100  Metabolic pathways
Module
heq_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:heq00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HPF32_0984 (gmk)
Enzymes [BR:heq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     HPF32_0984 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_16 Thymidylate_kin AAA_17 MMR_HSR1 RNA_helicase RsgA_GTPase ABC_tran AAA_22 AAA_5 ADK AAA_33 CPT Rad17 AAA_29 dNK T2SSE NTPase_1 Cytidylate_kin Podovirus_Gp16 AAA_28 Zeta_toxin NACHT APS_kinase TsaE Mg_chelatase AAA_30
Motif
Other DBs
NCBI-ProteinID: BAJ58566
UniProt: E6NL49
Position
1054386..1055006
Genome map
AA seq 206 aa AA seqDB search
MHNDFNLLILSGPSGAGKSTLTKYLQEKIPKTHFSLSTTTRKPREGEVDGLHYNFVSEEE
FKQGIEKGQFLEWAIVHNHYYGTSKIPVEKALKEGKIVIFDIDVQGHEILKKHYPNACSV
FISTKNQEILKERLLLRGTDSKEMIEKRLINAYKEMQCLESFDYLIINEDLEKSKEIILS
IAKTLVYRLKAFNFEKICKAWKNESL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgcataatgattttaatttactcatcctttcaggccctagcggagcgggtaaaagcacc
cttacaaagtatttgcaagaaaaaatcccaaaaacccatttttccctttccaccaccaca
cgaaagcctagagagggcgaagttgatggcttgcattataattttgtcagcgaagaggaa
ttcaaacaaggcatagaaaaagggcagtttttagaatgggcgatcgtgcataaccactat
tatggcacttctaaaatccctgtagaaaaagccttaaaagagggcaaaattgtcattttt
gatattgatgtgcaagggcatgagatccttaaaaagcattaccccaacgcatgctctgtg
tttattagcaccaaaaaccaagagattttaaaagagcgcttgcttttaagggggacggat
tctaaagagatgatagaaaagcgcttgatcaacgcttataaggaaatgcagtgcttggag
agctttgattacctcatcatcaatgaagatttagaaaaatccaaagaaatcatcttaagc
atcgcaaaaactttagtctatcgcttaaaagcgtttaattttgaaaaaatatgcaaggct
tggaaaaacgaatccttataa

DBGET integrated database retrieval system