KEGG   Helicobacter pylori F32: HPF32_1206Help
Entry
HPF32_1206        CDS       T01911                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
heq  Helicobacter pylori F32
Pathway
heq00260  Glycine, serine and threonine metabolism
heq00400  Phenylalanine, tyrosine and tryptophan biosynthesis
heq01100  Metabolic pathways
heq01110  Biosynthesis of secondary metabolites
heq01130  Biosynthesis of antibiotics
heq01230  Biosynthesis of amino acids
Module
heq_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:heq00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPF32_1206 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPF32_1206 (trpA)
Enzymes [BR:heq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPF32_1206 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB ThiG
Motif
Other DBs
NCBI-ProteinID: BAJ58788
UniProt: E6NLS1
Position
complement(1291470..1292258)
Genome map
AA seq 262 aa AA seqDB search
MRYKNMFETLKKQEKMAFIPFVTLGDPNYEWSFEIIKTLIASGVSALELGFAFSDPVADG
VTIQASHLRALKHASMAKNFQLLRAVRDYNPHIPIGLLAYANLIFSYGVDNFYAQIKECG
VDSVLIADMPLIEKELVLKSAQKHQIKQIFIASPNASNKDLEQAAMHSQGYIYTLARSGV
TGASRILENDASAIIKTLKAFSPTPALLGFGISKKEHITNAKNMGADGVICGSALVKIIE
ENLNDENAMLEKIKGFVGEMIF
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaggtataaaaacatgtttgaaaccttaaaaaaacaagaaaaaatggcgtttatcccg
tttgtaaccttgggcgatcctaattatgaatggagttttgaaatcattaaaaccttaatt
gctagcggggtgagtgctttagagttgggttttgctttttctgatccggtagcggatggc
gttaccatacaagcgagccatttaagggcgttaaaacacgctagcatggctaaaaatttc
cagcttttaagggcggtcagagattacaatccccacattcccatagggcttttagcgtat
gcaaatctcattttttcttatggcgtggataatttttacgcccaaatcaaagaatgcggc
gtggatagcgttttaatagcggatatgcccctaatagaaaaagaattagtcctaaaatcc
gctcaaaaacaccagattaaacaaatctttatcgccagccccaatgcgagcaataaagat
ttagaacaagccgctatgcattcgcaaggctatatctacactttagctaggagtggggtt
acaggggcgagccgtattttagaaaatgacgcgagcgctattattaaaaccctaaaagct
tttagccctacaccggccttattaggctttggcatttctaaaaaagaacacatcacaaac
gctaaaaacatgggcgctgatggcgtgatttgcggctcagcattagtcaaaatcatagaa
gaaaatttgaacgatgaaaacgccatgttggaaaaaattaaagggtttgtgggagaaatg
attttttaa

DBGET integrated database retrieval system