KEGG   Helicobacter pylori Rif1: C695_00420Help
Entry
C695_00420        CDS       T02317                                 

Definition
(GenBank) hypothetical protein
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
her  Helicobacter pylori Rif1
Pathway
her00020  Citrate cycle (TCA cycle)
her00620  Pyruvate metabolism
her01100  Metabolic pathways
her01110  Biosynthesis of secondary metabolites
her01120  Microbial metabolism in diverse environments
her01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:her00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C695_00420
   00620 Pyruvate metabolism
    C695_00420
Enzymes [BR:her01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     C695_00420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox_2 NAD_binding_8 Pyr_redox_3 Lycopene_cycl Pyr_redox FAD_binding_2 Thi4 PEX-1N K_oxygenase Amino_oxidase
Motif
Other DBs
NCBI-ProteinID: AFV42899
Position
complement(90152..91504)
Genome map
AA seq 450 aa AA seqDB search
MSMEFDAVIIGGGVSGCATFYTLSEYSSLKRVAIVEKCSKLAQISSSAKANSQTIHDGSI
ETNYTPEKAKKVRLSAYKTRQYALNKGLQNEVIFETQKMAIGVGDEECEFMKKRYESFKE
IFVGLEEFDKQKIKELEPNVILGANGIDRHENIIGHGYRKDWSTMNFAKLSENFVEEALK
LKPNNQVFLNFKVKKIEKRNDTYAVISEDAEEVYAKFVLVNAGSYALPLAQSMGYGLDLG
CLPVAGSFYFVPDLLRGKVYTVQNPKLPFAAVHGDPDAVIKGKTRIGPTALTMPKLERNK
CWLKGISLELLKMDLNKDVFKIAFDLMSDKEIRNYVFKNMVFELPIIGKRKFLKDAQKII
PSLSLEDLEYAHGFGEVRPQVLDRTKRKLELGEKKICTHKGITFNMTPSPGATSCLQNAL
VDSQEIAAYLGESFELERFYKDLSPEELEN
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgagtatggaatttgatgctgttattattggaggtggggtttcagggtgcgcgaccttt
tatactttgagcgaatacagctctttaaagcgcgtggctatcgtggaaaaatgctctaaa
ttggctcaaatcagctccagcgctaaagctaattcgcaaaccattcatgatggctctatt
gaaacgaattacactcccgaaaaagctaaaaaagtgcgtttgagcgcttataagaccagg
caatacgctttgaataaaggcttgcaaaatgaagtgatttttgaaacccagaaaatggct
ataggcgtgggcgatgaagaatgcgagttcatgaaaaaacgctacgaatcttttaaagaa
atctttgtggggttagaagaatttgacaagcaaaagattaaagaattagagcctaatgtg
attttaggggctaatggcatagacaggcatgaaaacattatcgggcatgggtatagaaag
gattggagcaccatgaattttgcgaagttgagtgaaaacttcgttgaagaagccctaaaa
ttaaagcctaacaaccaggtgtttttgaatttcaaagtgaaaaagattgaaaaacgcaac
gacacttacgccgtaatttcagaagacgctgaagaagtgtatgctaaattcgtgctggtc
aatgccggctcttacgctttgcctttggctcagagcatgggctatggcctagatttaggg
tgcttgcctgtggcgggcagcttttattttgtgccggatttattaaggggtaaggtttat
accgttcaaaaccccaaactcccttttgcagccgtgcatggcgaccctgatgccgtcatt
aaaggaaaaacacgaatcgggcctaccgctttaacgatgcctaaattagaacgcaacaaa
tgttggcttaagggcattagcttggaattgttgaaaatggatttgaataaagatgtgttt
aaaattgcgtttgatttgatgagcgataaagaaatccgaaattatgtgtttaaaaacatg
gtttttgaattgcccattatcggtaaaaggaaatttttaaaagacgctcaaaaaatcatc
ccctctcttagcctagaagatctagaatacgctcatggttttggtgaagtgcgcccgcaa
gttttagacagaaccaagcgaaaactggaattaggcgaaaaaaagatttgcacccataaa
ggcatcacttttaacatgaccccttctccaggcgcgacgagttgtttgcaaaacgccctt
gtggattcccaagaaatcgctgcgtatttgggcgagagctttgaattagaacgcttttat
aaagatttatccccagaagaattggaaaattaa

DBGET integrated database retrieval system