KEGG   Helicobacter pylori Rif1: C695_05255Help
Entry
C695_05255        CDS       T02317                                 

Definition
(GenBank) 7-alpha-hydroxysteroid dehydrogenase
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
her  Helicobacter pylori Rif1
Pathway
her00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:her00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    C695_05255
Enzymes [BR:her01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     C695_05255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR RRM_3 Epimerase
Motif
Other DBs
NCBI-ProteinID: AFV43821
Position
1077809..1078597
Genome map
AA seq 262 aa AA seqDB search
MNGSNHMKNKTLVISGATRGIGKAIFVRFAQSGVNIAFTYNKNVEEANKIIEDVEQKYSI
KAKAYSLNVLEPEQYTELFKQIDADFDRVDFFISNAIIYGRSVVGGFAPFMRLKPKGLNN
IYTATVLAFVVGAQEAAKRMQKIGGGAIVSLSSTGNLVYMPNYAGHGNSKNAVETMVKYA
AVDLGEFNIRVNAVSGGPIDTDALKAFPDYVEIKEKVEEQSPLKRMGNPNDLAGAAYFLC
DETQSGWLTGQTIVVDGGTTFK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaatggttccaatcacatgaaaaataaaaccctagtgatcagcggcgcgactagaggg
attggcaaggcgatatttgtacgcttcgctcaaagcggcgtgaatatcgctttcacttac
aataaaaatgttgaagaagccaacaaaatcatagaagatgtggagcaaaaatattccatt
aaagccaaagcctactctcttaatgttttagagcctgagcaatacacggagcttttcaag
caaattgacgctgattttgacagagtggatttttttatttctaacgctattatttatggg
cgttctgtcgtggggggatttgcaccgtttatgcgattaaaacctaaggggttaaacaac
atttacacagccaccgtgttagcgttcgtcgtaggggctcaagaagcggcaaaacgcatg
caaaaaataggcggtggggcgatcgtgagcttaagttctaccgggaatctagtttatatg
cctaattacgccgggcatggcaattccaaaaacgccgtagaaaccatggtcaaatacgct
gccgtggatttaggcgaatttaacattagagtgaatgcggttagtggcgggcctattgat
acggacgctttgaaagccttccctgattatgtggagattaaagaaaaagtagaagagcaa
tcgcccctaaaacgcatgggcaatcctaacgatctagccggagcggcttattttttatgc
gatgagacccaaagcggttggcttacagggcaaacgatcgttgtagatggcgggactact
tttaaataa

DBGET integrated database retrieval system