KEGG   Helicobacter pylori Rif1: C695_07240Help
Entry
C695_07240        CDS       T02317                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
her  Helicobacter pylori Rif1
Pathway
her00220  Arginine biosynthesis
her00330  Arginine and proline metabolism
her01100  Metabolic pathways
her01110  Biosynthesis of secondary metabolites
her01130  Biosynthesis of antibiotics
her01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:her00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    C695_07240
   00330 Arginine and proline metabolism
    C695_07240
Enzymes [BR:her01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     C695_07240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AFV44216
Structure
PDB: 

Position
1459940..1460908
Genome map
AA seq 322 aa AA seqDB search
MILVGLEAELGASKRGTDKGVRRLREALSATHGDVIKGMQTITQERCVLYKEFRYAKNFE
DYYLFCKENLIPCMKEVFEKKEFPLILSSEHANMFGIFQAFRSVHKDKKIGILYLDAHAD
IHTAYDSDSKHIHGMPLGMVLNRVRSGFNRMSESEEKAWQKLCSLGLEKGGLEIDPKCLV
YFGVRSTEQSERDVIRELQIPLFSVDAIRENMQEVVQKTKESLKAVDIIYLSLDLDIMDG
KLFTSTGVRENNGLSFDELKQLLGLLLESFKDRLKAVEVTEYNPTVSIKHNNEEEKQVLE
ILDLIINSCKIKDKKHSFARSY
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgattttagtaggattagaagcagagttaggagcgtcaaaaagaggcaccgataaaggg
gttaggcgtttgagagaggctttaagcgccacgcatggcgatgtgattaaaggcatgcaa
acgatcactcaagagcggtgcgtgctttataaagagtttagatacgctaagaattttgaa
gattactaccttttttgtaaagaaaatctgatcccttgcatgaaagaagtgtttgaaaaa
aaagaattccctttgattttaagctcagagcatgcgaacatgtttgggattttccaagcc
tttaggagcgttcataaggacaaaaaaatagggattttgtatttagacgcgcatgcggat
attcacacggcttatgacagcgattcaaagcatatccacggcatgcctttaggcatggtt
ttaaatcgtgtccgtagtgggtttaatcgcatgagcgagagcgaagaaaaggcatggcaa
aagctttgctctttggggttagaaaagggagggttagaaattgatcctaaatgtttggtg
tattttggggtaagaagcaccgaacagagcgaaagagatgtgattagggaattgcaaatc
cctttatttagcgtggatgcgataagagaaaacatgcaagaagtggttcaaaaaaccaaa
gaatcattaaaagcggtggatattatttatctcagtttggatttggacattatggatggc
aagcttttcacttctaccggtgtgcgtgaaaataacgggctgagttttgatgagctcaag
caattactgggtttgcttttagaaagttttaaagaccgattaaaagcggttgaggtaacc
gaatacaaccccacggtgagtataaaacacaataacgaagaagaaaagcaggttttagag
atcttagatctcatcatcaatagctgtaaaattaaagataagaagcactcttttgcaagg
agttactga

DBGET integrated database retrieval system