KEGG   Helicobacter pylori SouthAfrica7: HPSA_02385Help
Entry
HPSA_02385        CDS       T01921                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
hes  Helicobacter pylori SouthAfrica7
Pathway
hes00471  D-Glutamine and D-glutamate metabolism
hes00550  Peptidoglycan biosynthesis
hes01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hes00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    HPSA_02385 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HPSA_02385 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hes01011]
    HPSA_02385 (murD)
Enzymes [BR:hes01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     HPSA_02385 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:hes01011]
 Precursor biosynthesis
  Amino acid ligase
   HPSA_02385 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C DUF3531 YrhK
Motif
Other DBs
NCBI-ProteinID: ADU84490
UniProt: E8QVL9
Position
485185..486453
Genome map
AA seq 422 aa AA seqDB search
MKISLFGHGKTTLALARFLKKNHNEVGFFDDRFTSFHKDKEGFLCYPSKDFNPNDSQLEI
VSPGISFTHPLVIKAKHLMSEYDYIDSLFDSSFTPTTISISGTNGKTTTTEMLTMLLEDF
KAVSGGNIGTPLIELFEKRSPLWVLETSSFSLHYTNKAYPLIYLLINVEADHLTWHCNFE
NYLNAKLKVLTLMPKTSLAILPLKFKEHPIVQNSQAQKIFFNKSEEILENLEIPSNALSF
KGAFLLDAALALLVYEQFLKIKNLKWQDYKENALKRLNAFKIGSHKMEEFRDKKGRLWVD
DSKATNIDATLQALKTFKHQKIHLILGGDIKGVNLTPLFEELKHYAISLYAIGSSAFVIQ
ALAQEFDLVCKVCLELEKAVQEIKSVLLHNEVALLSPSAASLDQFSSYKERGEKFKAFVL
ED
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatctctttgtttgggcatggcaaaaccactctagccttggcgcgttttttgaaa
aaaaaccataacgaagtgggattttttgatgaccgattcacttcatttcataaggataaa
gagggttttctttgttatcccagtaaggattttaaccccaatgattcccagctagaaata
gtcagccctggcattagttttacgcaccctttagtgataaaagccaagcatttaatgagc
gaatacgattatattgatagtctctttgattcttctttcacgcccactactataagcatt
agcggcaccaatggtaaaaccaccacgacagaaatgctcaccatgcttttagaagatttt
aaggctgtgagtggggggaatatcggcacgcccttgattgaattgtttgaaaaacgatcg
cctttgtgggtgctagaaacaagctctttttctttgcactacactaacaaggcttaccct
ttgatttatttgctcatcaatgtggaagccgatcacttaacttggcattgcaattttgaa
aattatttgaacgctaaactcaaggttttaacattgatgcctaaaacttccctagctatc
ctccctttaaaattcaaagaacatccaattgtgcaaaattcgcaagcgcaaaaaatcttt
tttaacaaaagcgaagaaattttggaaaatttagaaatcccttctaacgccctttctttt
aagggagcgtttttattagacgccgccttagctcttttagtttatgagcaatttttaaaa
ataaagaatttaaaatggcaagattataaagaaaacgcccttaaaagattgaacgctttt
aaaatcggttcgcataaaatggaggaatttagggataaaaaggggcgtttgtgggtagat
gacagcaaggctacgaatattgatgccaccttgcaagccctaaaaacttttaaacaccaa
aaaatccatttgattttagggggcgatattaaaggggtcaatttaacccccctttttgaa
gagttgaaacattatgcaataagcctttatgcgataggctcaagcgcttttgttatccag
gctttagcacaagaatttgatcttgtttgtaaggtttgcttggagttagaaaaagcggtt
caagaaatcaaaagcgttttattacacaatgaagtcgctttgctttcacctagcgcggcc
agtttggatcaattttcttcgtataaagaaaggggtgaaaaatttaaggcgtttgtttta
gaagattaa

DBGET integrated database retrieval system