KEGG   Helicobacter pylori SouthAfrica7: HPSA_03270Help
Entry
HPSA_03270        CDS       T01921                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hes  Helicobacter pylori SouthAfrica7
Pathway
hes00071  Fatty acid degradation
hes00072  Synthesis and degradation of ketone bodies
hes00280  Valine, leucine and isoleucine degradation
hes00310  Lysine degradation
hes00362  Benzoate degradation
hes00380  Tryptophan metabolism
hes00620  Pyruvate metabolism
hes00630  Glyoxylate and dicarboxylate metabolism
hes00640  Propanoate metabolism
hes00650  Butanoate metabolism
hes00900  Terpenoid backbone biosynthesis
hes01100  Metabolic pathways
hes01110  Biosynthesis of secondary metabolites
hes01120  Microbial metabolism in diverse environments
hes01130  Biosynthesis of antibiotics
hes01200  Carbon metabolism
hes01212  Fatty acid metabolism
hes02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hes00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPSA_03270
   00630 Glyoxylate and dicarboxylate metabolism
    HPSA_03270
   00640 Propanoate metabolism
    HPSA_03270
   00650 Butanoate metabolism
    HPSA_03270
  Lipid metabolism
   00071 Fatty acid degradation
    HPSA_03270
   00072 Synthesis and degradation of ketone bodies
    HPSA_03270
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HPSA_03270
   00310 Lysine degradation
    HPSA_03270
   00380 Tryptophan metabolism
    HPSA_03270
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPSA_03270
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HPSA_03270
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HPSA_03270
Enzymes [BR:hes01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HPSA_03270
Exosome [BR:hes04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPSA_03270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ADU84653
UniProt: E8QW32
Position
671819..672994
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAVGSFLGSLKNVSARQMGVSVLKDALKASGLEPNDVDSVILGNVLGAG
LGQNIARQIQLDAGIPNDRHAFSVNMVCGSSLKAIQLAHDSIMLGRDEVVVCGGVENMSA
APYLSFDMREGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNIAKIYHISREEQDAFAF
QSQLKARVAINAGKFQEEITPIEIASKKGTMVFKEDEYPRDTTLESLAKLKPAFQKDGSV
TAGNSSGINDGASVVVLCSAKKAQELVLKVMATIKGFGLGGCSPDIMGICPSIAIKNNLK
NVKMNTNDIHLFELNEAFAAQSIAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRNGHGVGCASLCVGGGQGISVVVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtagcggcaaagcgtagcgctgtggggagttttttaggctct
ttgaaaaatgtgagcgctaggcaaatgggcgttagcgtgcttaaagacgctctgaaggcg
agcggacttgagccaaatgatgtagattctgtcattttaggcaatgtcttaggcgctggt
ttgggtcaaaatatcgccagacagatccaactagacgctggcatccctaatgatcggcat
gcttttagcgttaatatggtttgcggatcgtccttgaaagccattcagttagcgcatgat
agcatcatgcttgggcgcgatgaagtggtggtgtgcggtggcgtagaaaacatgagtgct
gcgccttatttgtcgtttgacatgcgagagggaaagagaatggggaatgcaaacatgata
gactccatgatacatgatgggctatgggatgcattcaatgattaccacatggggatcacc
gcagacaatatcgctaaaatataccacataagccgagaagaacaagacgcattcgcattc
caatcgcaactcaaagcaagagtcgctatcaatgcagggaaattccaagaagaaatcact
cccattgaaatagcgagtaaaaaaggcacgatggttttcaaagaagacgaataccctaga
gacacgacgctagaatcccttgcaaagctcaaacctgctttccaaaaagacggatcggta
acagcaggaaattcatcagggatcaatgatggcgctagcgtagtggttttatgcagcgct
aaaaaagcgcaagagttagtgctaaaagtcatggccactatcaaggggtttggtttgggc
ggttgcagtccggatataatgggtatatgcccaagcatcgcaattaaaaacaaccttaaa
aatgtcaaaatgaacaccaacgacatccatctttttgaactcaatgaagcctttgccgct
caaagcatagccgtattaaaagagcttgaattaaaccctaatatcgtgaatgtgaatggt
ggtgcgatagcgattggccatcctattggagcgagcggcgctaggatattggttaccctt
ttgcatgaaatgaagcgaaatgggcatggtgtgggttgtgcgtcgttgtgcgtgggtggc
gggcaaggaatatcagtggtagttgaacaaaaataa

DBGET integrated database retrieval system