KEGG   Helicobacter pylori SouthAfrica7: HPSA_04160Help
Entry
HPSA_04160        CDS       T01921                                 

Definition
(GenBank) ADP-glyceromanno-heptose 6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
hes  Helicobacter pylori SouthAfrica7
Pathway
hes00540  Lipopolysaccharide biosynthesis
hes01100  Metabolic pathways
Module
hes_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:hes00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HPSA_04160
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hes01005]
    HPSA_04160
Enzymes [BR:hes01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     HPSA_04160
Lipopolysaccharide biosynthesis proteins [BR:hes01005]
 Unusual sugar
  HPSA_04160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 KR adh_short_C2 Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: ADU84819
UniProt: E8QS55
Position
complement(838346..839338)
Genome map
AA seq 330 aa AA seqDB search
MRYIDDELENQTILITGGAGFVGSNLAFYFQDNHPKAKVIILDKFRNNTLSSNGRPSSLG
HFKNLIGFKGEVITADINNPLDLRRLEKLHFDYLFHQAAISDTTMLNQELVMKTNYQAFL
RLLEIAQPKKAKVIYASSAGVYGNTKAPNVVGSNESPENVYGFSKLCMDEFVRSYSSDLI
QVGLRFFNVYGPREFYKEKTASMVLQLALQALAFKEVKLFEFGEQLRDFVYIEDVIQANV
KAMKAQKSGVYNVGYSQARSYNEIVSILKEHLGDFKVSYIKNPYPFFQEHTQAHIEPTIL
DLDYTPLYDLESGIKDYLPHIHAIFKEQYA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatattgatgatgagttagaaaatcaaacgattttaattaccggtggggctggt
tttgtgggcagtaatttagccttttattttcaagataaccaccctaaagctaaagtgatc
attttagataaattccgtaacaacacgctttcaagtaatggccgcccgagttctttaggg
cattttaagaatttaatcggttttaagggtgaagtgatcacggctgatattaataaccct
ttagatttaaggcgtttagaaaagttgcattttgattatttgttccaccaggccgctatt
tctgatacgaccatgctcaatcaagaattagtgatgaaaaccaactaccaggctttttta
cggcttttagaaatcgcccaacccaaaaaggctaaagtgatttacgcttcttcagcgggc
gtttatggcaacaccaaagcccccaatgtggtaggctcaaacgaaagccctgaaaatgtt
tatggcttttccaagctttgcatggacgaatttgtccgctcttattcaagcgatctcatt
caagtgggcttacgattttttaatgtctatgggcctagggaattttataaggaaaaaacc
gcctctatggttttgcaactcgctttgcaagcgctggcgtttaaggaagtcaagcttttt
gaatttggcgagcagttaagggattttgtctatattgaagatgtgatccaagcgaatgtg
aaagcgatgaaagcccaaaaaagcggggtttataatgtgggctattcacaagccaggagc
tataatgagattgttagcattttaaaagagcatttaggggattttaaagtgagctatatt
aaaaacccttatccttttttccaagagcacacgcaagcgcatattgaacccactattttg
gatttagactacacccccttatacgatttagaaagcggcattaaggattatttgcctcat
atccatgcgatttttaaagaacaatacgcatga

DBGET integrated database retrieval system