KEGG   Helicobacter pylori SouthAfrica7: HPSA_06290Help
Entry
HPSA_06290        CDS       T01921                                 

Definition
(GenBank) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
hes  Helicobacter pylori SouthAfrica7
Pathway
hes00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hes01100  Metabolic pathways
hes01110  Biosynthesis of secondary metabolites
hes01130  Biosynthesis of antibiotics
hes01230  Biosynthesis of amino acids
Module
hes_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hes00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPSA_06290
Enzymes [BR:hes01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HPSA_06290
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     HPSA_06290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI
Motif
Other DBs
NCBI-ProteinID: ADU85226
UniProt: E8QTB2
Position
complement(1293132..1294490)
Genome map
AA seq 452 aa AA seqDB search
MPSVLENILKDKLLEVSALKKNHPLPASINPSDRDFKKALLEKKTSFILECKKASPSKGL
IRKDFDLLKIAKVYEKFASCISVLADSKYFLGSYENIKIVSQHSTKPILCKDFILDSFQV
KLARVMGANAVLLMLSALDDKNYLELFELAKSLNMSVLTEVSNKQEIGRLLKLQYDIIGI
NNRDLHTLKTDTLHTLELRPLLPKDALIISESGIHSHAQIKALAPYVNGFLVGSSLMKEK
DLKKACIKLILGENKVCGLTRIKDAKAVYKNHFIYGGLIFEKSSPRYIKPKKALKITKAV
KKLDFVGVFVKDKIKKIAKIAQKLDLKAVQLYNYSPKEMAQLKKALPKTCTIWQVVNVAD
SKDLAPKTKEASLILYDAKGDKMGGNGVSFDWGILENAKTPFMLAGGLNLNNAQKALKIK
ALGLDFNSGLEISPGIKNKGKIKRLARILREY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcctagcgtgttagaaaatatccttaaagacaaacttttagaagtttctgcactcaaa
aaaaaccaccctttgcctgcaagcataaacccaagcgacagggattttaaaaaagcgtta
ctggaaaaaaagacaagctttattttagagtgcaaaaaagcatcgccctctaaaggcttg
atcagaaaagattttgatctgttaaaaatagcgaaggtttatgaaaaatttgcctcttgc
atttcggttttagccgattctaaatattttttaggctcttatgaaaacattaagattgtc
tcacaacattccaccaagcccattttgtgcaaagactttatccttgatagtttccaggtc
aaactcgctagggttatgggggctaatgcggtgcttttaatgctaagcgcgctagatgat
aaaaactatttagagctttttgaactcgccaagtccttaaacatgagcgtgttaacggaa
gtttctaacaagcaagaaatcgggcgcttgctcaaactccaatacgacattataggcatc
aataacagggatttacacaccttaaaaaccgatacgctccacacgctagaattacgcccc
cttttgcctaaagatgcgctcatcattagcgagtccggtatccattcgcatgcgcaaatc
aaagccctagccccttatgtgaatggctttttagtgggaagctctttaatgaaagaaaag
gatttgaaaaaagcgtgcattaaattgattttaggcgaaaacaaagtgtgcggtcttaca
agaatcaaagacgctaaagccgtctataaaaaccattttatttatggaggtttgattttt
gaaaaatcttcgcccagatatattaaacccaaaaaagccctaaaaatcacaaaagcggtt
aaaaaattggattttgtgggcgtgtttgtgaaagataaaattaaaaaaatcgcaaaaatc
gctcaaaagcttgatttaaaagcggtgcaactctataactattcgcctaaagaaatggct
caattaaaaaaagcgctccctaaaacttgcacgatctggcaagtagtgaatgtggcggat
tctaaagatttagcgcccaaaactaaagaagcctctttaatcttatacgacgctaaaggg
gataaaatgggaggcaatggcgtgagttttgattggggtattttagaaaatgccaaaacg
cctttcatgttagccggtgggcttaatttgaacaacgctcaaaaagccttgaaaattaaa
gcgttgggtttggatttcaattctggtttagaaataagccctgggattaaaaataagggt
aaaatcaagcggttagcccgcattttaagagagtattaa

DBGET integrated database retrieval system