KEGG   Helicobacter pylori SouthAfrica7: HPSA_07370Help
Entry
HPSA_07370        CDS       T01921                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
hes  Helicobacter pylori SouthAfrica7
Pathway
hes00220  Arginine biosynthesis
hes00330  Arginine and proline metabolism
hes01100  Metabolic pathways
hes01110  Biosynthesis of secondary metabolites
hes01130  Biosynthesis of antibiotics
hes01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hes00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    HPSA_07370
   00330 Arginine and proline metabolism
    HPSA_07370
Enzymes [BR:hes01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     HPSA_07370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ADU85423
UniProt: E8QUE1
Structure
PDB: 

Position
complement(1492018..1492986)
Genome map
AA seq 322 aa AA seqDB search
MILVGLEAELGASKRGTDKGVRRLREALSATHGDVIKGMQTITQERCVLYKEFRYAKNFE
DYYLFCKENLIPCMKEVFEKKEFPLILSSEHANMFGIFQAFRSVHKDKKIGILYLDAHAD
IHTAYDSDTKHIHGMPLGMVLNRVHSGVNPMSESEEKAWQKLCSLGLEKGGLEIDPKCLV
YFGVRSTEQSERDVIKELQIPLFSVGAIRENMQGVVQKTKELLKAVDIIYLSLDLDIMDG
KLFTSTGVRENNGLSFDELKQLLGLLLESFKDRLKAIEVTEYNPTVSTKHNNEEEKQVLE
ILDLIINSCKFKDKKHSFIMSS
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgattttagtaggattagaagcagagttaggagcgtcaaaaagaggcaccgataaaggg
gttaggcgtttgagagaagctttaagtgcgacgcatggcgatgtgattaagggcatgcaa
acgatcactcaagagcgttgcgtgctttataaagagtttagatacgctaagaattttgaa
gattactaccttttttgtaaagaaaatttgatcccttgcatgaaagaagtgtttgaaaaa
aaagaatttcctttgatcttaagctcagagcatgcgaacatgtttgggattttccaagcc
tttaggagcgttcataaggacaaaaaaatagggattttgtatctagatgcgcatgcggat
attcacacggcttatgacagcgatacaaagcatatccacggcatgcctttaggcatggtt
ttaaatcgtgtccatagcggggttaatcctatgagcgaaagcgaagaaaaggcatggcaa
aagctttgctctttggggttggaaaagggagggttagaaattgatcctaaatgtttggtg
tattttggggtgagaagcaccgaacagagcgaaagagatgtgattaaggaattacaaatc
cctttatttagcgtgggcgcgataagagaaaacatgcaaggagtggttcaaaaaaccaaa
gaattattaaaagcggtggatattatttaccttagcttggatttagacattatggatggc
aagcttttcacttctaccggcgtgcgtgaaaataacgggctgagttttgatgagctcaag
cagttactgggcttgcttttagaaagttttaaagacagattaaaagcgattgaggtaacc
gaatacaaccccacggtgagcaccaaacacaataacgaagaagaaaagcaggttttagag
atcttagatctcatcatcaatagctgtaaatttaaagataagaagcactcttttataatg
agtagctga

DBGET integrated database retrieval system