KEGG   Helicobacter sp. MIT 01-6242: BBW65_01620Help
Entry
BBW65_01620       CDS       T05984                                 

Definition
(GenBank) hypothetical protein
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
het  Helicobacter sp. MIT 01-6242
Brite
KEGG Orthology (KO) [BR:het00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:het03009]
    BBW65_01620
Enzymes [BR:het01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     BBW65_01620
Ribosome biogenesis [BR:het03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    BBW65_01620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: ANV98725
UniProt: A0A1B1U7S2
Position
complement(349538..350494)
Genome map
AA seq 318 aa AA seqDB search
MSQEDFKENTKLRIDSFVSQWLCVSKNQASQAIKNHCVCVNQKPCDKNGLMLKIGDCVEF
VPLKQEATEIKCCFDEEIEVLFEDEEILVLNKPPHWVVHQAPSVKEATLVDYLKSKNFSL
STISGEERYGIVHRLDKQTSGAIAIAKTNHAHQALSEQLKTRAMGRYYLAIIDLPIKETM
EVECFLGRNPNHRLKIAKLKSGGRYSKSTFVPLLSKQVSLIAAKLHTGRTHQIRAHLESV
SRHIIGDTLYGKSDAYQTRLMLHAYLLYLIHPTTGQRIEIQAPLFGDMLGFLNNNFALEE
VYEVINQEHFLHLFGDRV
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atatctcaagaggattttaaagagaacacaaaactaagaattgattcttttgtgagtcaa
tggctttgtgtgagcaaaaatcaagcctcccaagccatcaaaaaccactgcgtttgtgtc
aatcaaaagccctgtgacaaaaatggtctgatgctcaaaatcggggattgtgtggagttt
gtgccattgaaacaagaagcaacagaaatcaaatgctgttttgatgaggagattgaggtt
ttgtttgaggatgaggagattttggtcctcaacaagccacctcattgggtcgtccatcaa
gctccaagcgtgaaagaagcgactttggtggattatctcaaatccaaaaacttctctctc
tcgacaatcagtggggaggagaggtatggcatcgtgcatagactagataagcaaacaagt
ggggcgatcgccatcgccaaaacaaaccacgcacatcaagctttgagcgaacagctcaaa
actcgtgcgatggggagatactatcttgcaatcattgatttgccaatcaaggaaacaatg
gaagtagaatgttttttgggacgcaatccaaaccatcgattgaaaatcgccaagctcaag
agtgggggtcgctattccaaaagcacatttgtgccattgcttagcaagcaagtctctttg
atagccgccaaactgcatacagggaggacacatcaaatccgtgcacatttggagagtgta
tcaaggcatatcatcggagatacgctctatggcaagagcgacgcttatcaaacgcgtttg
atgcttcatgcttatttgctttatctgattcaccctaccacagggcagaggatagagata
caggcaccgctatttggagatatgttggggtttttaaacaataattttgcattggaggaa
gtttatgaagttattaatcaagagcattttttgcatctttttggggatagggtttag

DBGET integrated database retrieval system