KEGG   Helicobacter sp. MIT 01-6242: BBW65_04455Help
Entry
BBW65_04455       CDS       T05984                                 

Definition
(GenBank) hypothetical protein
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
het  Helicobacter sp. MIT 01-6242
Pathway
het00564  Glycerophospholipid metabolism
het01100  Metabolic pathways
het01110  Biosynthesis of secondary metabolites
Module
het_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:het00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BBW65_04455
Enzymes [BR:het01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     BBW65_04455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4131 Ac81
Motif
Other DBs
NCBI-ProteinID: ANV98097
UniProt: A0A1B1U5M5
Position
953959..954561
Genome map
AA seq 200 aa AA seqDB search
MNLQTFYITQSGFKICITLLFALLLTLLFEYNILAFLITTCLVFCLFIFRNPERSDKHIS
QDAFLAPIDGIIENILSQNQETIIVVKTGILDAGVVRAPYTSDTYEINKTNGIPLYFSTS
KHHLAPHFYLKTPNFSIDVQQELLSTIPFDPIMPTLERNERIGFLKCGISTISVKNLKIQ
VNIGDKIRGGESILGYINEN
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgcagacattttacattacgcaaagtggcttcaaaatctgcatcacccttctc
tttgcgctattattgacattgttatttgaatacaatatcttggcttttttgattacaaca
tgtcttgtgttttgtttgtttatttttagaaaccccgaacgctctgataagcatatttca
caagatgcttttcttgcacccatcgatggaatcattgaaaacattttgagtcaaaatcaa
gaaacaatcattgtggtcaaaactggcatattggatgcaggagttgtgcgtgcaccatat
acttctgacacctatgagatcaacaagaccaatggcataccactttatttttccacttcc
aaacaccacctagctccgcacttttatctcaaaactccaaatttttctatcgatgtccaa
caagagctactatccacaatcccctttgatccaataatgccgacacttgaacgcaatgag
aggattgggtttttgaaatgtgggattagcaccattagcgtcaaaaacctcaagattcaa
gtcaatattggtgacaaaattagaggtggagaaagcattttaggatacatcaatgaaaat
taa

DBGET integrated database retrieval system