KEGG   Helicobacter pylori Puno135: HPPN135_00980Help
Entry
HPPN135_00980     CDS       T01920                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
heu  Helicobacter pylori Puno135
Pathway
heu00010  Glycolysis / Gluconeogenesis
heu00051  Fructose and mannose metabolism
heu01100  Metabolic pathways
heu01110  Biosynthesis of secondary metabolites
heu01120  Microbial metabolism in diverse environments
heu01130  Biosynthesis of antibiotics
heu01200  Carbon metabolism
heu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:heu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPPN135_00980 (tpiA)
   00051 Fructose and mannose metabolism
    HPPN135_00980 (tpiA)
   00562 Inositol phosphate metabolism
    HPPN135_00980 (tpiA)
Enzymes [BR:heu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HPPN135_00980 (tpiA)
Exosome [BR:heu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HPPN135_00980 (tpiA)
  Exosomal proteins of bladder cancer cells
   HPPN135_00980 (tpiA)
  Exosomal proteins of melanoma cells
   HPPN135_00980 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEN17904
UniProt: G2M7I9
Structure
PDB: 

Position
190765..191469
Genome map
AA seq 234 aa AA seqDB search
MTKIAMANFKSAMPIFKSHAYLGELEKTLKPQHFDRVFVFPDFLGLLPNSFLHFTLGAQN
AYPRDCGAFTGEITLKHLEELKINTLLIGHSERRLLLKESPSFLKEKFDFFKSKNFKIVY
CIGEELTTREKGFKAVKEFLNEQLENIDLNYPNLVVAYEPIWAIGTKKSASLEEIYLTHG
FLKQILNQKTPLLYGGSVNVQNAKEILGIDSVDGLLIGSTSLELENFKTIISFL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattgctatggctaattttaaatccgctatgcctatttttaaaagccatgcg
tatttaggagaattagaaaagactttaaaaccgcagcattttgatagggtgtttgtattc
cctgattttttggggttattgcctaattcgtttttgcatttcactttaggagcgcaaaac
gcttaccctagagattgtggggcttttaccggtgaaatcactttaaagcatttagaagaa
ctcaaaatcaacacgcttttaatagggcatagcgagaggcgattgcttttaaaggaaagc
cctagctttttgaaagaaaagtttgatttttttaaaagtaaaaattttaaaattgtctat
tgcattggcgaagaattaacgaccagagaaaagggttttaaggctgtaaaggaattttta
aacgagcaattagaaaatattgatcttaattatcccaatttagtggtggcgtatgagcct
atttgggcgattggcacaaaaaagagcgcttctttagaagagatttacctcacgcatggt
tttttaaagcaaattttaaatcaaaaaacgcccttgttgtatggggggagcgtgaatgtg
caaaacgctaaagaaattttagggattgatagcgtggatggcttgttgatcgggagcacg
tctttggaattagaaaattttaaaacaatcatttcatttttataa

DBGET integrated database retrieval system