KEGG   Helicobacter pylori Puno135: HPPN135_03400Help
Entry
HPPN135_03400     CDS       T01920                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
heu  Helicobacter pylori Puno135
Pathway
heu00071  Fatty acid degradation
heu00072  Synthesis and degradation of ketone bodies
heu00280  Valine, leucine and isoleucine degradation
heu00310  Lysine degradation
heu00362  Benzoate degradation
heu00380  Tryptophan metabolism
heu00620  Pyruvate metabolism
heu00630  Glyoxylate and dicarboxylate metabolism
heu00640  Propanoate metabolism
heu00650  Butanoate metabolism
heu00900  Terpenoid backbone biosynthesis
heu01100  Metabolic pathways
heu01110  Biosynthesis of secondary metabolites
heu01120  Microbial metabolism in diverse environments
heu01130  Biosynthesis of antibiotics
heu01200  Carbon metabolism
heu01212  Fatty acid metabolism
heu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:heu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPPN135_03400
   00630 Glyoxylate and dicarboxylate metabolism
    HPPN135_03400
   00640 Propanoate metabolism
    HPPN135_03400
   00650 Butanoate metabolism
    HPPN135_03400
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HPPN135_03400
   00072 Synthesis and degradation of ketone bodies
    HPPN135_03400
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HPPN135_03400
   00310 Lysine degradation
    HPPN135_03400
   00380 Tryptophan metabolism
    HPPN135_03400
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPPN135_03400
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HPPN135_03400
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HPPN135_03400
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:heu04147]
    HPPN135_03400
Enzymes [BR:heu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HPPN135_03400
Exosome [BR:heu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPPN135_03400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEN18378
UniProt: G2M9S0
Position
695393..696568
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAIGSFLGSLKSVGAREMGAVVLKDALKASGLKPSDVDSVILGNVLSAG
LGQNIARQIQLDAGIPNDRNAFSVNMVCGSSMKAIQLAHDSIMLGRDEVVVCGGVENMSM
APYLSFDMRDGKRMGNANMIDSMICDGLWDAFNDYHMGITADNVAQAYHISREEQDAFAL
QSQLKARVAINAGKFQEEITPIEIANKKGVVVFKEDEYPRETTLESLAKLKPAFKKDGSV
TAGNSSGINDGASVIILCSAQKVQKLGLKTMAAIKGFGLGGCSPDIMGICPSIAIKNNLK
NVKMNLNDINLFELNEAFAAQSIAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSAQSVGCASLCVGGGQGLSVIVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtggcagcaaaacgaagcgctatagggagttttttaggctct
ctaaagagcgtgggcgctagagaaatgggtgctgtcgtgcttaaagacgctttgaaggcg
agcggtcttaagcctagcgatgtggattctgtcattttaggcaatgttttatccgccggt
ttgggtcaaaatatcgccaggcagatccaactagacgctggcatcccgaatgacaggaac
gcttttagcgtcaatatggtttgtggatcgtctatgaaagccattcaattagcgcatgac
agcatcatgcttgggcgcgatgaggtggtggtgtgcggtggcgtggaaaacatgagcatg
gcaccctatctgtcgtttgacatgcgagatgggaaaagaatggggaatgcgaacatgata
gactccatgatctgtgacggattgtgggatgcgttcaatgattaccacatggggatcacc
gctgataatgtcgctcaagcataccacatcagccgagaagagcaagatgctttcgcgctc
caatcgcaactcaaagcaagagtcgccattaatgcagggaaattccaagaagaaatcacg
cccattgaaatagcgaataaaaaaggcgtggtggtttttaaagaagacgaataccctaga
gaaacgacgctagaatcccttgcaaagctcaaacccgctttcaaaaaagacggatcggta
acggcaggaaattcatcagggatcaatgatggcgcgagtgttatcattttatgcagcgct
caaaaagtgcaaaaattggggttaaaaacaatggcggctatcaaggggtttggtttgggt
ggttgcagtccggatataatggggatatgccctagcatcgctattaaaaacaaccttaaa
aatgtcaaaatgaatctcaatgacatcaatctttttgaactcaatgaagccttcgctgca
caaagcatagccgtgttaaaagagcttgaattaaaccctaatatcgtgaatgtgaatgga
ggcgcaatagccattggccaccctattggtgcgagcggcgctaggatcttagtaacttta
ttgcatgaaatgaaaagaagcgctcaaagcgtgggctgcgcgtcattgtgtgtgggcggc
ggacaagggctatcagtaatagtggaacaaaaataa

DBGET integrated database retrieval system