KEGG   Helicobacter pylori Puno135: HPPN135_05670Help
Entry
HPPN135_05670     CDS       T01920                                 

Gene name
porD
Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit delta
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
heu  Helicobacter pylori Puno135
Pathway
heu00010  Glycolysis / Gluconeogenesis
heu00020  Citrate cycle (TCA cycle)
heu00620  Pyruvate metabolism
heu00640  Propanoate metabolism
heu00650  Butanoate metabolism
heu00680  Methane metabolism
heu01100  Metabolic pathways
heu01120  Microbial metabolism in diverse environments
heu01130  Biosynthesis of antibiotics
heu01200  Carbon metabolism
Module
heu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:heu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPPN135_05670 (porD)
   00020 Citrate cycle (TCA cycle)
    HPPN135_05670 (porD)
   00620 Pyruvate metabolism
    HPPN135_05670 (porD)
   00640 Propanoate metabolism
    HPPN135_05670 (porD)
   00650 Butanoate metabolism
    HPPN135_05670 (porD)
  Energy metabolism
   00680 Methane metabolism
    HPPN135_05670 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPPN135_05670 (porD)
Enzymes [BR:heu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPPN135_05670 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_6 Fer4_10 Fer4_2 Fer4_9 Fer4_17 Fer4_15 Fer4_7 Fer4_16 Fer4_8 Fer4_4 Fer4_13 Fer4_18 Fer4_22 Fer4_3
Motif
Other DBs
NCBI-ProteinID: AEN18799
UniProt: G2MAB3
Position
1159657..1160049
Genome map
AA seq 130 aa AA seqDB search
MKDWNEFEMGAVLFPFEKNAQSEMEKHNDERHYTEQSYFTTSVAHWRVAKPVHNNNICIN
CFNCWVYCPDAAILSREGKLKGVDYSHCKGCGVCVDVCPTNPKSLWMFEEQIDLASALTQ
WPQKQEKKKS
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattggaatgaatttgaaatgggagcggtgctcttcccttttgaaaaaaacgcg
caaagcgaaatggaaaaacacaatgatgagcgccattacaccgagcaaagctacttcacc
acttcagtggctcattggcgcgtggctaagcctgtgcataacaataacatttgcatcaat
tgctttaattgttgggtttattgcccagatgctgctatcctttcaagagagggcaagtta
aaaggcgtggattattctcattgtaaaggctgtggcgtgtgcgtggatgtctgccccacc
aaccctaaatcgctatggatgtttgaagaacaaattgatcttgctagcgctctcactcaa
tggccgcaaaaacaagaaaagaaaaaatcgtaa

DBGET integrated database retrieval system