KEGG   Helicobacter pylori F57: HPF57_0484Help
Entry
HPF57_0484        CDS       T01912                                 

Definition
(GenBank) 7-alpha-hydroxysteroid dehydrogenase
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
hex  Helicobacter pylori F57
Pathway
hex00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:hex00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    HPF57_0484
Enzymes [BR:hex01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     HPF57_0484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: BAJ59558
UniProt: E6NQZ2
Position
complement(489362..490150)
Genome map
AA seq 262 aa AA seqDB search
MNNSNHMKNKTLVISGATRGIGKAILYRFAQSGVNIAFTYNKNVEEANKIIEDVEQKYSI
KAKAYPLNVLEPEQYTELFKQIDADFDRVDFFISNAIIYGRSVVGGFAPFMRLKPKGLNN
IYTATVLAFVVGAQEAAKRMQKIGGGAIVSLSSTGNLVYMPNYAGHGNSKNAVETMVKYA
AVDLGEFNIRVNAVSGGPIDTDALKAFPDYMEIKEKVEEQSPLKRMGNPNDLAGAAYFLC
DETQSGWLTGQTIVVDGGTTFK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaacaattccaatcacatgaaaaataaaaccctagtgatcagtggcgcaactagaggg
attggcaaggcgatattgtatcgcttcgctcaaagcggcgtgaatatcgctttcacttac
aataaaaatgttgaagaagccaacaaaattatagaagatgtggagcaaaaatattccatt
aaagccaaagcctaccctctcaatgttttagagcctgagcaatacacagagctttttaaa
caaattgacgctgattttgacagagtggatttttttatttctaatgctattatttatggg
cgttctgtcgtgggcggattcgcaccgtttatgcgattaaaacctaaggggttgaacaat
atttacacagccactgtgttagcgtttgtagtgggggctcaagaagcggcaaaacgcatg
caaaaaataggtggcggggcgatcgtgagcttaagctctaccgggaatttggtctatatg
cctaattacgctgggcatggcaattctaaaaacgccgtagaaaccatggtcaaatacgct
gctgttgatttaggcgagtttaacattagagtgaatgcggtgagtggcggacctattgat
acggacgctttgaaagccttccctgattatatggagattaaagaaaaagtagaagagcaa
tcgcccctaaaacgcatgggcaatcctaacgatctagccggagcggcttattttttatgc
gatgaaacccaaagcggttggcttacagggcaaacgatcgttgtagatggcgggactact
tttaaataa

DBGET integrated database retrieval system