KEGG   Helicobacter pylori F57: HPF57_0531Help
Entry
HPF57_0531        CDS       T01912                                 

Gene name
pldA
Definition
(GenBank) phospholipase A1
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
hex  Helicobacter pylori F57
Pathway
hex00564  Glycerophospholipid metabolism
hex00565  Ether lipid metabolism
hex00592  alpha-Linolenic acid metabolism
hex01100  Metabolic pathways
hex01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hex00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    HPF57_0531 (pldA)
   00565 Ether lipid metabolism
    HPF57_0531 (pldA)
   00590 Arachidonic acid metabolism
    HPF57_0531 (pldA)
   00591 Linoleic acid metabolism
    HPF57_0531 (pldA)
   00592 alpha-Linolenic acid metabolism
    HPF57_0531 (pldA)
Enzymes [BR:hex01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     HPF57_0531 (pldA)
    3.1.1.32  phospholipase A1
     HPF57_0531 (pldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1
Motif
Other DBs
NCBI-ProteinID: BAJ59605
UniProt: E6NR39
Position
541456..541764
Genome map
AA seq 102 aa AA seqDB search
MVAYWPYIPYDQSNPNLIDYMGYGNAKVDYRRGRHHFELQLYDIFTQYWRYDRWHGAFRL
GYTYRINPFVGIYAQWFNGYGDGLYEYDVFSNRIGVGIRLNP
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atggtcgcttattggccctatatcccttatgatcaatccaaccctaatttgattgattac
atggggtatggtaacgctaaagttgattacaggagagggcgccatcattttgaattgcaa
ctttatgatattttcacgcaatactggcgttatgatcgctggcatggggctttccgctta
ggctatacctaccgcattaacccttttgtggggatttatgcgcagtggtttaacggctat
ggcgatggcttgtatgaatacgatgttttttccaatcgtataggggtaggaatacgctta
aacccttaa

DBGET integrated database retrieval system