KEGG   Helicobacter pylori F57: HPF57_0715Help
Entry
HPF57_0715        CDS       T01912                                 

Gene name
thl
Definition
(GenBank) acetyl coenzyme A acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hex  Helicobacter pylori F57
Pathway
hex00071  Fatty acid degradation
hex00072  Synthesis and degradation of ketone bodies
hex00280  Valine, leucine and isoleucine degradation
hex00310  Lysine degradation
hex00362  Benzoate degradation
hex00380  Tryptophan metabolism
hex00620  Pyruvate metabolism
hex00630  Glyoxylate and dicarboxylate metabolism
hex00640  Propanoate metabolism
hex00650  Butanoate metabolism
hex00900  Terpenoid backbone biosynthesis
hex01100  Metabolic pathways
hex01110  Biosynthesis of secondary metabolites
hex01120  Microbial metabolism in diverse environments
hex01130  Biosynthesis of antibiotics
hex01200  Carbon metabolism
hex01212  Fatty acid metabolism
hex02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hex00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPF57_0715 (thl)
   00630 Glyoxylate and dicarboxylate metabolism
    HPF57_0715 (thl)
   00640 Propanoate metabolism
    HPF57_0715 (thl)
   00650 Butanoate metabolism
    HPF57_0715 (thl)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HPF57_0715 (thl)
   00072 Synthesis and degradation of ketone bodies
    HPF57_0715 (thl)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HPF57_0715 (thl)
   00310 Lysine degradation
    HPF57_0715 (thl)
   00380 Tryptophan metabolism
    HPF57_0715 (thl)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPF57_0715 (thl)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HPF57_0715 (thl)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HPF57_0715 (thl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hex04147]
    HPF57_0715 (thl)
Enzymes [BR:hex01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HPF57_0715 (thl)
Exosome [BR:hex04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPF57_0715 (thl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAJ59789
UniProt: E6NRM3
Position
753309..754484
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAVGSFLGSLKSVSAREMGVSVLKDALNASALKPSDVDSVILGNVLSAG
LGQNIARQIQLDAGIPNDRNAFSVNMVCGSSMKAIQLAHDSIMLGRDEVVVCGGVENMSA
APYLSFDMRDGKRMGNANMIDSMIYDGLWDAFNDYHMGITADNVAQAYHISREEQDAFAL
QSQLKARAAINAGKFQEEITPIEIANKKGVVVFKEDEYPRETTLESLAKLKPAFKKDGSV
TAGNSSGINDGASIIILCNAQKAQKLGLKTMATIKGFGLGGCSPDIMGICPSIAIKNNLK
NVKMNLNDINLFELNEAFAAQSIAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSAHGVGCASLCVGGGQGLSVIVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtggcggcaaaacgaagtgctgtggggagttttttaggctct
ctaaagagcgtgagcgctagagaaatgggtgttagcgtgcttaaagacgctctgaatgcg
agcgctcttaagcctagcgatgtggattctgtcattttaggcaatgttttatccgctggt
ttgggtcaaaatatcgccagacagatccaactggacgctggcatcccgaatgacaggaac
gcttttagcgtcaatatggtttgtggatcgtctatgaaagccattcaattagcgcatgac
agcatcatgcttgggcgcgatgaggtggtggtgtgcggtggcgtggaaaacatgagtgca
gccccctatttgtcgtttgacatgcgagacgggaaaagaatggggaatgcgaacatgata
gactccatgatatatgacggattgtgggatgcgttcaatgattaccacatggggatcacc
gctgataatgtcgctcaagcataccacatcagccgagaagagcaagatgctttcgcgctc
caatcgcaactcaaagcaagagccgccattaatgcagggaaattccaagaagaaatcacg
cccattgaaatagcgaataaaaaaggcgtggttgtttttaaagaagacgaataccctaga
gaaacgacgctagaatcccttgcaaagctcaaacccgctttcaaaaaagacggatcggta
acggcaggaaattcatcagggatcaatgatggcgcgagtattatcattttatgcaacgct
caaaaagcgcaaaaattggggttaaaaacaatggcaactatcaaagggtttggtttgggt
ggttgcagtccggatataatggggatatgccctagtattgctattaaaaacaatcttaaa
aatgtcaaaatgaatctcaatgacatcaatctttttgaactcaatgaagctttcgccgcg
caaagcatagccgtgttaaaagagcttgaattaaaccccaatatcgtgaatgtgaatgga
ggcgcaatagccattggccaccctattggcgcaagcggtgctaggatcttagtaacttta
ttgcatgaaatgaaaagaagtgctcatggcgtgggttgtgcgtcattgtgtgtgggcggc
ggacaagggctatcagtaatagtggaacaaaaataa

DBGET integrated database retrieval system