KEGG   Helicobacter pylori XZ274: MWE_0582Help
Entry
MWE_0582          CDS       T02130                                 

Definition
(GenBank) ADP-glyceromanno-heptose 6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
hey  Helicobacter pylori XZ274
Pathway
hey00540  Lipopolysaccharide biosynthesis
hey01100  Metabolic pathways
Module
hey_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:hey00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    MWE_0582
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hey01005]
    MWE_0582
Enzymes [BR:hey01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     MWE_0582
Lipopolysaccharide biosynthesis proteins [BR:hey01005]
 Unusual sugar
  MWE_0582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind NAD_binding_4 KR Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: AFJ81467
UniProt: I2DFF1
Structure
PDB: 

Position
520527..521519
Genome map
AA seq 330 aa AA seqDB search
MRYIDDELENQTILITGGAGFVGSNLAFYFQENHPKAKVVILDKFRSNTLFSNKRLSSLG
HFKNLIGFKGEVVIADINNPLDLRRLEKLHFDYLFHQAAVSDTTMLDQELVMKTNYQAFL
NLLEIARPKKAKVIYASSAGVYGNTKAPNVVGKNESPENVYGFSKLCMDEFVLSHSNDNI
QVGLRYFNVYGPKEFYKEKTASMVLQLALGIMAFKEVKLFEFGEQLRDFVYIEDVIQANV
KAMKAQKSGVYNVGYSQARSYNEIVSILKEHLGDFKVTYIKNPYAFFQNHTQAHIEPTIL
DLDYTPLYDLESGIKDYLPHIHAIFKEQRA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatattgatgatgaattagaaaatcaaacgattttaatcaccggtggggctggc
tttgtaggcagtaatctggccttttattttcaagagaaccaccctaaagctaaagtggta
attttggataaatttcgcagtaacacacttttcagtaataagcgccttagttccttaggg
cattttaagaatttaatcggttttaagggtgaggtggttatcgctgatattaataacccc
ttagatttaaggcgtttagaaaaattgcattttgattatttgttccaccaagccgctgtc
tctgatacgaccatgctggatcaagaattagtgatgaaaaccaattatcaggctttttta
aaccttttagaaatcgctcgcccaaaaaaagctaaagtgatttacgcttcttcagcgggc
gtttatggcaacaccaaagcccccaatgtggtaggcaaaaacgaaagccctgaaaatgtt
tatggcttttccaagctttgcatggacgaatttgtcctctcccattcaaatgacaatatt
caagtgggcttaaggtattttaatgtttatgggcctaaggaattttataaagaaaaaacc
gcttctatggttttgcaactcgccttaggcataatggcgtttaaggaagtcaaacttttt
gaatttggcgagcaattaagggattttgtctatattgaagatgtgatccaagcgaatgtg
aaagcgatgaaggctcaaaaaagcggggtttataatgtgggttattcccaagccagaagt
tataatgaaatagttagcattttaaaagagcatttaggggattttaaagtaacttatatc
aaaaacccttatgctttcttccaaaatcacacccaagcacatattgaacctactattttg
gatttagactacacccctttatacgatttagagagtggcattaaagattatttgccccat
atccatgcgatttttaaagaacagcgtgcatga

DBGET integrated database retrieval system