KEGG   Helicobacter pylori XZ274: MWE_0816Help
Entry
MWE_0816          CDS       T02130                                 

Definition
(GenBank) putative acetyl coenzyme A acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hey  Helicobacter pylori XZ274
Pathway
hey00071  Fatty acid degradation
hey00072  Synthesis and degradation of ketone bodies
hey00280  Valine, leucine and isoleucine degradation
hey00310  Lysine degradation
hey00362  Benzoate degradation
hey00380  Tryptophan metabolism
hey00620  Pyruvate metabolism
hey00630  Glyoxylate and dicarboxylate metabolism
hey00640  Propanoate metabolism
hey00650  Butanoate metabolism
hey00900  Terpenoid backbone biosynthesis
hey01100  Metabolic pathways
hey01110  Biosynthesis of secondary metabolites
hey01120  Microbial metabolism in diverse environments
hey01130  Biosynthesis of antibiotics
hey01200  Carbon metabolism
hey01212  Fatty acid metabolism
hey02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hey00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MWE_0816
   00630 Glyoxylate and dicarboxylate metabolism
    MWE_0816
   00640 Propanoate metabolism
    MWE_0816
   00650 Butanoate metabolism
    MWE_0816
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MWE_0816
   00072 Synthesis and degradation of ketone bodies
    MWE_0816
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MWE_0816
   00310 Lysine degradation
    MWE_0816
   00380 Tryptophan metabolism
    MWE_0816
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MWE_0816
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MWE_0816
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MWE_0816
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hey04147]
    MWE_0816
Enzymes [BR:hey01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MWE_0816
Exosome [BR:hey04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MWE_0816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AFJ81651
UniProt: I2DFY5
Position
complement(726598..727773)
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAVGSFLGSLKSVGAREMGVSVLKDALKASGLKPSDVDSVILGNVLGAG
LGQNIARQIQLDAGIPNDRNAFSVNMVCGSSMKAIQLAHDAIMLGRDEVVVCGGVENMSK
APYLSFDMRDGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNVAQAYHISREEQDAFAL
QSQLKARAAINAGKFQEEITPIEIANKKGVVVFKEDEYPRETTLESLAKLKPAFKKDGSV
TAGNSSGINDGASIIVLCSTQKAQKLGLKTMATIKGFGLGGCSPDIMGICPSIAIKNNLK
NVKMNLNDINLFELNEAFAAQSIAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSAHSVGCASLCVGGGQGLSVVVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtggcggcaaaacgaagcgcagtggggagttttttaggctct
ctaaagagcgtgggcgctagagaaatgggtgttagcgtgcttaaagacgctctgaaagcg
agcggtcttaagcctagcgatgtggattctgtcattttaggcaatgttttaggcgccggt
ttgggtcaaaatatcgccagacagatccaactggacgctggcatcccgaatgacaggaac
gcttttagcgtcaatatggtttgtggatcgtctatgaaagccattcaattagcacatgat
gccatcatgcttgggcgcgatgaggtggtggtgtgcggtggcgtggaaaacatgagcaaa
gcaccctatttgtcgtttgacatgcgagatgggaaaagaatggggaatgcgaacatgata
gactccatgatacatgatggattgtgggatgctttcaatgattaccacatggggatcact
gctgataatgtcgctcaagcataccacatcagccgagaagagcaagatgctttcgcgctc
caatcgcaactcaaagcaagagccgccattaatgcagggaaattccaagaagaaatcacg
cccattgaaatagcgaataaaaaaggcgtggttgtttttaaagaagacgaataccctaga
gaaacgacgctagaatcccttgcaaagctcaaacccgctttcaaaaaagacggatcggta
acggcaggaaattcatcagggatcaatgatggtgcgagtattatcgttttatgcagcact
caaaaagcgcaaaaattggggttaaaaaccatggcaactatcaaggggtttggtttgggt
ggttgcagtccggatataatgggcatatgccctagcattgcgattaaaaacaaccttaaa
aatgtcaaaatgaatctcaacgacatcaatctttttgaactcaatgaagcctttgccgcg
caaagcatagccgtgttaaaagagcttgaattaaaccccaatatcgtgaatgtgaatgga
ggcgcaatagccattggccaccctattggtgcgagcggcgctaggatcttagtaacttta
ttgcatgaaatgaaaagaagtgctcatagcgtgggttgcgcgtcattgtgtgtgggtggc
ggacaagggctatcggtggtagtggaacaaaaataa

DBGET integrated database retrieval system