KEGG   Helicobacter pylori XZ274: MWE_1205Help
Entry
MWE_1205          CDS       T02130                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
hey  Helicobacter pylori XZ274
Pathway
hey00450  Selenocompound metabolism
hey00970  Aminoacyl-tRNA biosynthesis
hey01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hey00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    MWE_1205
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MWE_1205
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hey01007]
    MWE_1205
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hey03016]
    MWE_1205
Enzymes [BR:hey01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     MWE_1205
Amino acid related enzymes [BR:hey01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   MWE_1205
Transfer RNA biogenesis [BR:hey03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    MWE_1205
 Prokaryotic type
   Other AARSs
    MWE_1205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e TrwB_AAD_bind SAC3_GANP
Motif
Other DBs
NCBI-ProteinID: AFJ81942
UniProt: I2DGS6
Position
complement(1096395..1098356)
Genome map
AA seq 653 aa AA seqDB search
MQKSLITTPIYYVNDVPHIGHAYTTLIADTLKKYYTLQGEEVFFLTGTDEHGQKIEQSAR
LRNQSPKAYADSISTIFKDQWDFFNLDYDGFIRTTDSEHQKCVQNAFEIMFEKGDIYKGA
YSGYYCVSCESYCAISKTDNTNDKVLCPDCLRETTLLEEESYFFRLSAYEKPLLDFYAKN
PEAILPVYRKNEVTSFIEQGLLDLSITRTSFEWGIPLPKKMNDPKHVVYVWLDALLNYAS
ALGYLNDLDNKMAHFACARHIVGKDILRFHAIYWPAFLMSLNLPLFKQLCVHGWWTIEGV
KMSKSLGNVLDAQKIAMEYGIEELRYFLLREVPFGQDGDFSKKALIERINANLNNDLGNL
LNRLLGMAKKYFNHSLKSAKITAYYSKELEKVHQILDNANSFVPKMQLHKALEELFSVYD
FLNKLIAKEEPWVLHKNNESEKLEALLSLIANALLQSSFLLYAFMPKSAAKLASAFHAEI
TPDNYERFFKAKKLQDMILQDTEPLFSKIEKIEKAEKAGEVLPEKNEKEEKEKKDAKEKA
PLKQENYISIEDFKKVEIKVGLIKEAQRIEKSNKLLRLKVDLGEGRLRQIVSGIALDYEP
ESLVGQMVCVVANLKPAKLMGEMSDGMILAVRDNDNLALISPTREKIAGSLIS
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaatcactgatcacaacccccatttattatgtgaatgatgtccctcatattggc
catgcttatacgactttgattgcggatactttaaagaagtattacacgcttcaaggcgaa
gaagtcttttttttaaccggcaccgatgagcatggacaaaagatcgaacaaagcgcgaga
ttgagaaatcaaagccctaaagcttacgctgatagcattagcacgatttttaaagaccag
tgggattttttcaatttagattatgatggttttatccgcaccacagacagcgagcatcaa
aaatgcgtgcaaaacgcctttgaaatcatgtttgaaaaaggggatatttataaaggtgct
tatagcgggtattattgcgtgagctgtgagagttattgtgcgatctctaaaacggacaat
acgaacgataaagtcttatgccctgattgcttgagagaaaccacgcttttagaagaagag
agttattttttcagattgagtgcgtatgagaagcctttattggatttttacgctaaaaac
cctgaagcgattttgcccgtttatcgtaaaaatgaggtaacttctttcattgagcagggt
ttattggatttgtctatcacgcgcacgagctttgaatggggcattcctttgcctaaaaaa
atgaacgatcctaaacatgtggtgtatgtttggctggacgctttattgaattatgcgagc
gcgctagggtatttgaatgatttagacaataaaatggcacattttgcatgcgctaggcat
attgtgggtaaggatattttacgcttccatgccatttattggccggcttttttgatgagt
ttgaatttgcccttattcaaacagctttgcgtgcatgggtggtggacgatagagggcgtg
aaaatgagtaagagcttgggtaatgttttagacgctcaaaaaatcgctatggagtatggg
attgaggaattgcgttattttttattgcgtgaagtgccttttgggcaagatggggatttt
tctaaaaaagcgttaatagaaagaatcaatgcgaatttgaataacgatttagggaatttg
ttgaatcgtttgctaggcatggctaaaaaatatttcaatcattctctaaaaagcgcaaaa
atcaccgcttattattctaaagagctagaaaaagtgcatcaaattttagataacgctaat
tcttttgtgcctaaaatgcaattgcataaagctttagaggaattgtttagcgtttatgat
tttttaaacaaactcatcgctaaagaagagccgtgggttttgcacaaaaacaacgaatca
gaaaaactagaagccttattgagtttgatcgcaaacgcgcttttacaatcaagctttttg
ctctatgcgttcatgccaaagagtgcggctaaattagcgagcgcttttcatgcagaaatt
acgcctgataattacgaacgcttttttaaagctaaaaaattacaagatatgattttacaa
gacaccgagcctttattttccaaaattgagaaaattgaaaaggctgaaaaagcgggagaa
gtcctaccagaaaaaaacgaaaaagaagaaaaagaaaaaaaagacgcaaaagaaaaagcc
ccactaaaacaagaaaactatatcagcattgaggattttaaaaaagtagagattaaagtg
gggcttatcaaagaagctcaaaggattgaaaaatccaataaattactgcgcttaaaagtg
gatttaggcgaaggccgtttgaggcagattgtctcagggattgctttggattatgagcct
gaaagtttggtgggtcaaatggtgtgcgtggtggctaatttaaaacccgcaaagcttatg
ggtgaaatgagtgatggcatgattttagcggtgcgagataatgataatctggctttaatc
agccctaccagagaaaaaattgcaggaagtttgattagctaa

DBGET integrated database retrieval system