KEGG   Helicobacter pylori XZ274: MWE_1290Help
Entry
MWE_1290          CDS       T02130                                 

Definition
(GenBank) porC, porG
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
hey  Helicobacter pylori XZ274
Pathway
hey00010  Glycolysis / Gluconeogenesis
hey00020  Citrate cycle (TCA cycle)
hey00620  Pyruvate metabolism
hey00640  Propanoate metabolism
hey00650  Butanoate metabolism
hey00680  Methane metabolism
hey01100  Metabolic pathways
hey01120  Microbial metabolism in diverse environments
hey01130  Biosynthesis of antibiotics
hey01200  Carbon metabolism
Module
hey_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hey00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MWE_1290
   00020 Citrate cycle (TCA cycle)
    MWE_1290
   00620 Pyruvate metabolism
    MWE_1290
   00640 Propanoate metabolism
    MWE_1290
   00650 Butanoate metabolism
    MWE_1290
  Energy metabolism
   00680 Methane metabolism
    MWE_1290
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MWE_1290
Enzymes [BR:hey01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MWE_1290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR MAF_flag10
Motif
Other DBs
NCBI-ProteinID: AFJ82002
UniProt: I2DGY6
Position
1172828..1173388
Genome map
AA seq 186 aa AA seqDB search
MFQIRWHARAGQGAITGAKGLADVISKTGKEVQAFASYGSAKRGAAMMAYNRIDDEPILN
HERFMQPDYVLVIDPGLVFIENIFANEKEDTIYIITSYLNKEGLFEKKPELKTRKVFLVD
CLKISMETLKRPIPNTPMLGALMKVSGMLEIGAFKEAFKKVLGKKLTQEVIDANMLAIQR
AYEEVQ
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaattagatggcatgcgcgagctggtcaaggcgcaatcactggcgctaaaggg
ctggctgatgtgatttcaaaaacaggcaaagaagtgcaagcgttcgcttcctatggttca
gctaaaaggggggctgctatgatggcttataaccgcattgatgatgagcctattttaaac
catgaacgcttcatgcagcctgattatgtgctggtgattgatcccggtttggttttcatt
gaaaacatcttcgccaatgaaaaagaagacacgatctatatcatcactagctatcttaac
aaagaaggattgtttgaaaaaaaacctgaattaaaaacccgtaaggtgtttttagtggat
tgtttaaagatctctatggaaaccttaaaacgccctatccccaacacgcccatgctaggg
gctttaatgaaagtgtctggcatgcttgaaattggggcttttaaagaagcttttaagaaa
gttttaggcaaaaaactcacgcaagaagtcattgacgctaacatgctcgctatccaaaga
gcttatgaagaagttcaataa

DBGET integrated database retrieval system