KEGG   Helicobacter pylori XZ274: MWE_1485Help
Entry
MWE_1485          CDS       T02130                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hey  Helicobacter pylori XZ274
Pathway
hey00010  Glycolysis / Gluconeogenesis
hey00030  Pentose phosphate pathway
hey00051  Fructose and mannose metabolism
hey00052  Galactose metabolism
hey00230  Purine metabolism
hey00500  Starch and sucrose metabolism
hey00520  Amino sugar and nucleotide sugar metabolism
hey00521  Streptomycin biosynthesis
hey01100  Metabolic pathways
hey01110  Biosynthesis of secondary metabolites
hey01120  Microbial metabolism in diverse environments
hey01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hey00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MWE_1485
   00030 Pentose phosphate pathway
    MWE_1485
   00051 Fructose and mannose metabolism
    MWE_1485
   00052 Galactose metabolism
    MWE_1485
   00500 Starch and sucrose metabolism
    MWE_1485
   00520 Amino sugar and nucleotide sugar metabolism
    MWE_1485
  Nucleotide metabolism
   00230 Purine metabolism
    MWE_1485
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MWE_1485
Enzymes [BR:hey01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     MWE_1485
    5.4.2.8  phosphomannomutase
     MWE_1485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AFJ82167
UniProt: I2DHF1
Position
1350573..1351949
Genome map
AA seq 458 aa AA seqDB search
MDISIFREYDIRGIYPTTLDEKSAFSIGVELGKIMREYDKSVFVGHDARVHGRSLFEALS
AGLQSSGLKVYDLGLIPTPVAYFAAFNEIDNIQCPNSIMITGSHNPKEYNGFKITLNQNP
FYGKDIQALKDTLLNAKHEIKPLKETPKKVNALEAYHRYLIKDFKHLKNLKYKIALDFGN
GVGALGLEPILKALNIDFSSLYSDPNGNFPNHHPDPSEAKNLQDLEKHMQENAILIGFAF
DGDADRIAMLSSHHIYAGDELAILFAKRLHAQGITPFVIGEVKCSQVMYNTINTFGKTLM
YKTGHSNLKIKLKETHAHFAAEMSGHIFFKERYFGYDDALYACLRALELLLEQTPNDLEN
TIKNLPYSYTTPEEKIAVSEEEKFEIIHSLQEALKNPPSHFPKIKEIISIDGVRVVFEHG
FGLIRASNTTPYLVSRFEGKDETTALEYKTALLNLLKK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggacattagcatttttagagaatatgatattagaggcatttaccccaccactttagac
gaaaaaagcgcctttagtatcggcgtggagttagggaaaatcatgcgagaatacgataaa
agcgtgtttgtagggcatgacgccagggtgcatgggcgatcgctttttgaagctttgagc
gcggggttacaatctagcggcttgaaagtgtatgatttagggctaatccccacaccggta
gcgtattttgcggcctttaatgaaatagacaacatccaatgccccaattccatcatgatc
actggctctcacaaccccaaagaatacaacggctttaaaatcacgctcaatcaaaacccg
ttttatggcaaggacattcaagctttaaaagacacgcttttaaacgccaagcatgaaata
aaacctctaaaagaaacaccaaagaaagtcaatgccctagaagcgtatcatcgctatttg
atcaaggattttaagcatttaaaaaaccttaaatacaaaatcgccctagattttggtaat
ggcgtgggagcgttaggcttagagcctattttaaaggctttaaacattgattttagcagc
ctttatagcgatcctaatgggaatttccctaaccaccacccagaccctagcgaagcgaaa
aacttacaagatttagaaaaacacatgcaagaaaacgctattttgataggctttgctttt
gatggcgatgcggacaggattgcgatgttaagctctcatcatatttatgcgggcgatgaa
ttagcgattttattcgctaaacgcttgcatgctcaaggcatcaccccctttgtgatcggc
gaagtcaaatgctctcaagtgatgtataacacgatcaatacttttggtaagacgctcatg
tataaaaccgggcatagcaatttaaaaatcaaactcaaagaaacccatgcgcattttgcg
gctgaaatgagcgggcatatcttttttaaagagcgctattttggctatgatgacgctctt
tatgcatgcttaagggctttagaattattgcttgaacaaaccccaaacgatttggaaaac
accattaaaaacctcccctattcctacaccacgcctgaagaaaaaatcgccgtgagcgaa
gaagaaaaatttgaaatcattcatagcctgcaagaagcgcttaaaaacccgccaagtcat
ttccctaaaatcaaagaaataatcagcattgatggcgtgagggtggtttttgaacatggt
tttgggcttattcgcgcaagcaacaccaccccgtatttagtcagccgctttgaaggcaaa
gatgaaacaacagcgttagagtataaaacggcattgctcaatttgctaaagaaataa

DBGET integrated database retrieval system