KEGG   Helicobacter pylori XZ274: MWE_1487Help
Entry
MWE_1487          CDS       T02130                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hey  Helicobacter pylori XZ274
Pathway
hey00260  Glycine, serine and threonine metabolism
hey00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hey01100  Metabolic pathways
hey01110  Biosynthesis of secondary metabolites
hey01130  Biosynthesis of antibiotics
hey01230  Biosynthesis of amino acids
Module
hey_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hey00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MWE_1487
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MWE_1487
Enzymes [BR:hey01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MWE_1487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFJ82169
UniProt: I2DHF3
Position
complement(1353508..1354689)
Genome map
AA seq 393 aa AA seqDB search
MNKKAYFGEFGGSFVSELLVPALRELEQAFDSCLKDEKFQKEYFHLLKDFVGRPSPLTLC
QNIVSNPKVKLYLKREDLIHGGAHKTNQALGQALVAKKMGKKRIIAETGAGQHGVATAIA
CALLGLKCVIFMGAKDIKRQEMNVFRMRLLGAEVREVDSGSATLKDAVNEALRDWASSYK
DTHYLLGTAAGPHPYPTMVKTFQKMIGDEVKSQILEKENRLPDYVIACVGGGSNAIGIFS
AFLNDKEVKLIGVEPAGLGLETNKHGATLNKGRVGILHGNKTYLLQDDEGQITESHSISA
GLDYPGVGPEHSYLKESGRAIYESASDLEALEAFSLLCQKEGIIPALESSHALAYALKLA
QKCEEESIIVVNLSGRGDKDLSTVYNALKGGLK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaagcgtattttggggagtttggagggagttttgtttcagaattgttagtg
cctgcattaagagaattagaacaggcgtttgattcgtgtttgaaagatgagaaattccaa
aaagaatatttccatcttttaaaagattttgtgggccgtcctagccccttaaccttgtgt
caaaatattgtttctaaccctaaagttaagctttatctaaaacgagaagatttaatccat
ggcggggcacacaaaactaatcaggctttagggcaagcccttgtagcgaaaaaaatgggt
aaaaaaaggattattgctgaaacaggcgctgggcagcatggcgtggcgacggctatcgct
tgcgcgttgttgggtttaaaatgcgtgatttttatgggggctaaagacatcaagcgccaa
gaaatgaatgtttttagaatgcgcttattaggtgctgaagtcagagaggttgattcaggg
agcgcgacgcttaaagacgctgtgaatgaagccttaagggattgggcgagcagttacaag
gacacgcattatttgctaggcacagccgccgggccacacccttaccctacgatggttaaa
acctttcaaaaaatgataggcgatgaggttaaaagccaaattttagaaaaagaaaaccgc
ttgcctgattatgttatcgcatgcgttggaggggggtctaacgctatagggatatttagc
gcgtttttaaacgataaagaggttaaactcataggtgtagagccagcaggtttagggcta
gaaaccaataagcatggagcgactttgaataaggggcgtgtggggattttgcatgggaat
aaaacctatcttttacaagatgatgaaggccagattacagaaagccacagcattagcgct
gggcttgattatccaggagtggggccagaacacagctatttaaaagagagcgggcgcgcg
atttatgaaagcgcaagcgatcttgaagcgctagaagcctttagtttgttgtgccaaaaa
gaaggcattatcccagcactagaaagctcacacgctttagcgtatgccttaaaactcgct
caaaaatgcgaagaagagagcatcattgtagtgaatttaagcggtcgtggggataaggat
ttaagcaccgtttataacgctttaaaaggaggtttaaaatga

DBGET integrated database retrieval system