KEGG   Helicobacter pylori XZ274: MWE_1729Help
Entry
MWE_1729          CDS       T02130                                 

Gene name
rocF
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
hey  Helicobacter pylori XZ274
Pathway
hey00220  Arginine biosynthesis
hey00330  Arginine and proline metabolism
hey01100  Metabolic pathways
hey01110  Biosynthesis of secondary metabolites
hey01130  Biosynthesis of antibiotics
hey01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hey00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    MWE_1729 (rocF)
   00330 Arginine and proline metabolism
    MWE_1729 (rocF)
Enzymes [BR:hey01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     MWE_1729 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AFJ82366
UniProt: I2DI00
Structure
PDB: 

Position
complement(1569006..1569974)
Genome map
AA seq 322 aa AA seqDB search
MILVGLEAELGASKRGTDKGVRRLREALSATHGDLIKSMQTIIQERCVLYKEFRYAKNFE
DYYLFCKENLIPCMKEVFEKKEFPLILSSEHANMFGIFQAFRSVHKDKKIGILYLDAHAD
IHTAYDSDSKHIHGMPLGMVLNRVRSGFNRMSESEEKAWQKLCSLGLEKGGLEIDPKCLV
YFGVRSTEQSERDVIKELQIPLFSVEAIRENMQEVVQKTKELLKAVDVIYLSLDLDIMDG
KLFTSTGVRENNGLSFDELKQLLGLLLENFKDRLKAVEVTEYNPTVSAKHTNEEEKQVLE
ILDLIINSCKIKDKKPSFTMSR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgattttagtaggattggaagcggaattaggagcgtcaaaaagaggcaccgataaaggg
gttaggcgtttgagagaagccttaagcgcaacgcatggcgatctgattaagagcatgcaa
acgattattcaagagcggtgcgtgctttataaagagtttagatacgctaagaattttgaa
gattactaccttttttgtaaagaaaatttgatcccttgcatgaaagaagtgtttgagaaa
aaagaatttcctttgattttaagctcagagcatgcaaacatgtttgggattttccaagcc
tttaggagcgttcataaggacaaaaaaatagggattttgtatttagatgcgcatgcggat
attcatacggcttatgacagcgattcaaagcatatccacggcatgcctttaggcatggtt
ttaaatcgtgtccgtagcgggttcaatcgcatgagtgagagcgaagaaaaggcatggcaa
aagctctgctctttggggttagaaaagggagggttagaaattgatcctaaatgtttggtg
tattttggggtaagaagcaccgaacagagcgaaagagatgtgattaaggaattgcaaatc
cctttatttagcgtggaagcgataagagaaaacatgcaagaagtggttcaaaaaaccaaa
gaattattaaaagcggtggatgttatttatttgagtttagatttagacattatggatggc
aagcttttcacttctaccggcgtgcgtgaaaataacgggctgagttttgatgaattaaag
caattactgggcttgcttttagaaaattttaaagacagattaaaagcggttgaggtaacc
gaatacaaccccacggtgagtgcaaaacacaccaacgaagaagaaaagcaggttttagag
atcttagatctcatcatcaatagctgtaaaattaaggataagaagccatcttttacaatg
agtcgctga

DBGET integrated database retrieval system