KEGG   Helicobacter pylori BM012S: U064_1054Help
Entry
U064_1054         CDS       T02940                                 

Definition
(GenBank) 23S ribosomal pseudouridine synthase D
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
hez  Helicobacter pylori BM012S
Brite
KEGG Orthology (KO) [BR:hez00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hez03009]
    U064_1054
Enzymes [BR:hez01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     U064_1054
Ribosome biogenesis [BR:hez03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    U064_1054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 DUF1062
Motif
Other DBs
NCBI-ProteinID: AHA89968
UniProt: V5NP53
Position
1074660..1075643
Genome map
AA seq 327 aa AA seqDB search
MQKVFIALTDHKRLDEFLAKELQISKNQVLNLIKEGLVFCQKKGVKKGGLALKKGDEITL
LTPKITPKPLKKGLDLEIEVIFEDEDLLVLNKPPNLVVHKAPSVKEPTLVDWLEFKNYEL
SNLGLKERYGIVHRLDKDTSGGIVIAKNNFTHVHLSEQLKTKMMGRYYIALLSTPLKEEK
MSVECYLTRNPNNRLKMIALKAAKKEKSRYSKSEFTSLLTSQNNLNLIGAKLFTGRTHQI
RAHLEYLNRHIIGDNLYGLNGALSKEEIRIMLHAYLIEFKHPRSEQKLRFKVPLLKDMLE
YLKKVFDKENLDEVLDEEKILHAFIAK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaagtttttatcgccctaaccgatcacaaacgccttgatgaatttttagccaaa
gaattgcaaatttctaaaaaccaggtattgaatttgattaaagaggggctggtgttttgt
caaaaaaagggagtaaaaaaaggggggctagccttaaaaaaaggcgatgaaatcacgctt
ttaacgcccaaaatcacgcccaaacccttaaaaaaagggcttgatttagaaatagaagtt
atttttgaagatgaagacttgttagtgttgaataagccccctaatttagtcgtccataaa
gccccaagcgtgaaagagcctactttagtggattggctggaatttaaaaattacgagctt
tctaatctgggattaaaagagcgctatgggattgtgcatcgtttggataaggacacaagc
ggggggattgtcatcgctaaaaacaattttacccatgttcatttgagcgagcaactcaaa
actaaaatgatggggcgctactatatcgccttgctttcaacgcccttaaaagaagaaaaa
atgagcgtggaatgctatttgacaagaaaccctaacaaccgcttaaaaatgatagcgctc
aaagcggccaaaaaagaaaaaagccgttattctaaaagcgaatttactagcctgctgact
tctcaaaataatcttaatttgataggggctaaactattcaccgggcgcacgcaccagatc
agagcgcatttagaatatttgaacagacacatcataggcgataatctttatgggcttaat
ggggcgctttctaaagaagaaataagaatcatgctgcatgcctatttgatagagttcaaa
caccctagaagcgagcagaaactgcgctttaaagttcccctattaaaggatatgttagaa
tatcttaaaaaagtttttgacaaggagaatttagatgaggtcttggatgaagaaaaaata
cttcacgcttttattgcaaagtag

DBGET integrated database retrieval system