KEGG   Helicobacter pylori BM012S: U064_1223Help
Entry
U064_1223         CDS       T02940                                 

Definition
(GenBank) 3-oxoacyl-[acyl-carrier protein] reductase
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
hez  Helicobacter pylori BM012S
Pathway
hez00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:hez00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    U064_1223
Enzymes [BR:hez01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     U064_1223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase
Motif
Other DBs
NCBI-ProteinID: AHA90133
UniProt: V5NPM7
Position
1242989..1243759
Genome map
AA seq 256 aa AA seqDB search
MKNKTLVISGATRGIGKAILYRFAQSGVNIAFTYNKNVEEANKIIEDVEQKYSIKAKAYS
LNVLEPEQYTELFKQIDADFDRVDFFISNAIIYGRSVVGGFAPFMRLKPKGLNNIYTATV
LAFVVGAQEAAKRMQKIGGGAIVSLSSTGNLVYMPNYAGHGNSKNAVETIVKYAAVDLGE
FNIRVNAVSGGPIDTDALKAFPDYVEIKEKVEEQSPLKRMGNPNDLAGAAYFLCDETQSG
WLTGQTIVVDGGTTFK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataaaaccctagtgatcagcggcgcgactagagggattggcaaggcgatattg
tatcgcttcgctcaaagcggcgtgaatatcgctttcacttacaataaaaatgttgaagaa
gccaacaaaatcatagaagatgtggagcaaaaatattccattaaagccaaagcctactcc
cttaatgttttagagcctgagcaatacacggagcttttcaagcaaattgacgctgatttt
gacagagtggatttttttatttctaacgctattatttatgggcgttctgtcgtgggggga
tttgcgccgtttatgcgattaaaacctaaggggttaaacaacatttacacagccaccgtg
ttagcgtttgtggtgggggctcaagaagcggcgaaacgcatgcaaaaaataggcggtggg
gcgatcgtgagcttaagctctaccgggaatttggtctatatgcctaattacgccgggcat
ggcaattccaaaaacgccgtagaaaccatagtcaaatacgctgctgtggatttaggcgaa
tttaacattagagtgaatgcggttagcggcgggcctattgatacagacgctttgaaagct
ttccctgattatgtggagattaaagaaaaagtagaagagcaatcgcccctaaaacgcatg
ggcaatcctaacgatttagccggagcggcttattttttatgcgatgaaacccaaagcggt
tggcttacagggcaaacgatcgttgtagatggcgggaccacttttaaataa

DBGET integrated database retrieval system