KEGG   Helicobacter pylori BM012S: U064_1517Help
Entry
U064_1517         CDS       T02940                                 

Definition
(GenBank) putative low-affinity inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
hez  Helicobacter pylori BM012S
Brite
KEGG Orthology (KO) [BR:hez00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    U064_1517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 RnlB_antitoxin NnrS DUF1240
Motif
Other DBs
NCBI-ProteinID: AHA90415
UniProt: V5NP86
Position
complement(1538989..1540590)
Genome map
AA seq 533 aa AA seqDB search
MEIKNIKEFEKASKKLQKDTLKIALALLFLIGVALLALIFGQANSKGLLLVFAAVIGGYM
AMNIGANDVSNNVGPAVGSKAISMGGAILIAGICEMLGAIIAGGEVVSTIKGRIVSPESI
NDAHVFINVMLASLLSGALWLHVATLIGAPVSTSHSVVGGIMGAGMAAAGMAAVNWHFLS
GIVASWVVSPLMGALIAMFFLMLIKKTIAYKEDKKSAALKVVPYLVALMSLTFSWYLIIK
VLKRLYALNFEIQLACGCILALLIFVLFKRFVLKKAPQLENSHESINELFNVPLIFAAAL
LSFAHGANDVANAIGPLAAISQTLEDANSPIGNTLSSVPLWIMVVGAAGIALGLSLYGPK
LIKTVGSEITELDKMQAFCIALSAVITVLLASQLGLPVSSTHIVVGAVFGVGFLRERLRE
QSRRRFARIRDNIVAAHFGEDLEEIEGFLERFDKANLKEKSLMLESLKKSKNTAIALELK
KKEKKSLKKVYKEEVIKRSILKKIVTAWLVTVPVSALLGALLFVALGFIEKYF
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaaaaacatcaaggagtttgaaaaagcttccaaaaaactccaaaaagacact
ttaaagatcgctctcgctcttttgtttctcattggcgttgctttgctcgctcttattttt
gggcaggctaattctaagggattgttgcttgtgtttgcggctgtgattggggggtatatg
gcgatgaatattggcgcgaatgatgtgtctaataatgtcggccctgccgtaggctctaaa
gccattagcatgggcggggcgattttgattgccgggatttgtgaaatgcttggagcgatc
attgctgggggtgaagtggtttctacgattaagggccgtatcgtttcgcctgaatccatt
aatgatgcgcatgttttcattaatgtcatgttggctagccttttgagtggggcgttgtgg
ttgcatgtagcgactttaattggcgctcccgtttccacttcacactctgtggtggggggg
attatgggggctggaatggcagcagctggaatggcagctgtcaattggcattttttatcc
ggtattgtagcgagttgggtggtttcgcctttaatgggggctttgatagccatgtttttt
ttaatgctcattaaaaagactatcgcttataaagaagataaaaagagtgcggctttaaag
gtcgtgccttatttggtagcgttgatgagcttaacattcagctggtatttgattattaag
gttttaaaacgcctctatgcgctgaattttgaaatccaattggcttgcggctgtatcctt
gcgcttttaatctttgtgctttttaaaagatttgtgttaaagaaagccccgcaattagaa
aacagccatgaaagcattaatgagcttttcaatgtccctttgatttttgccgctgcgctt
ttaagctttgcgcatggggctaatgatgtggctaacgctataggccccttagcggcgatc
agtcaaactttagaagatgcaaatagccccatagggaatactttaagctctgtgccgttg
tggattatggtagtaggggcagctgggattgctttaggcttgagtttgtatgggccaaag
ctcattaaaacggtggggtcagaaatcacagaattagacaaaatgcaagccttttgcatc
gcgctttctgcagtcattaccgtgcttttagcctctcaattaggcttgcccgtaagctct
acgcatattgtggtgggcgcggtgtttggggtgggctttttaagggagcgcttaagagag
caatcaagaaggcgttttgctaggatcagagacaacattgtagcggcgcactttggggaa
gatttagaagaaattgaaggttttttagagcgctttgataaagccaatttgaaagaaaaa
tcgctcatgctagagagcttgaaaaaaagcaagaacaccgccatcgctttggaattgaaa
aagaaagaaaaaaagtcgcttaaaaaagtgtataaagaagaggtgatcaagcgttccatt
ttaaaaaagattgttaccgcttggttggtaaccgtgccggtttctgcgcttttgggggcg
cttttgtttgtggctcttggttttatagaaaagtatttctag

DBGET integrated database retrieval system