KEGG   Helicobacter pylori BM012S: U064_1561Help
Entry
U064_1561         CDS       T02940                                 

Definition
(GenBank) Arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
hez  Helicobacter pylori BM012S
Pathway
hez00220  Arginine biosynthesis
hez00330  Arginine and proline metabolism
hez01100  Metabolic pathways
hez01110  Biosynthesis of secondary metabolites
hez01130  Biosynthesis of antibiotics
hez01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hez00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    U064_1561
   00330 Arginine and proline metabolism
    U064_1561
Enzymes [BR:hez01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     U064_1561
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase Tfb2_C
Motif
Other DBs
NCBI-ProteinID: AHA90458
UniProt: V5NQH8
Structure
PDB: 

Position
complement(1590907..1591875)
Genome map
AA seq 322 aa AA seqDB search
MILVGLEAELGASKRGTDKGVRRLREALSATHGDVIKGMQTITQERCVLYKEFRYAKNFE
DYYLFCKENLIPCMKEVFEKKEFPLILSSEHANMFGIFQAFRSVHKDKKIGILYLDAHAD
IHTAYDSDSKHIHGMPLGMVLNRVRSGFNRMSESEEKAWQKLCSLGLEKGGLEIDPKCLV
YFGVRSTEQSERDVIKELQIPLFSVEAIRENMQEVVQKTKESLKAVDIIYLSLDLDIMDG
KLFTSTGVRENNGLSFDELKQLLGLLLESFKDRLKALEVTEYNPTVSVKHNNEEEKQVLE
ILDLIINSCKFKDKKRSFARSY
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgattttagtaggattggaagcggaattaggagcgtcaaaaagaggcaccgataaaggg
gttaggcgtttgagagaagctttaagcgccacgcatggcgatgtgattaaaggcatgcaa
acgatcactcaagagcggtgcgtgctttataaagagtttagatacgctaagaattttgaa
gattactaccttttttgtaaagaaaatttgatcccttgcatgaaagaagtgtttgagaaa
aaagaattccctttgattttaagctcagagcatgcgaacatgtttgggattttccaagcg
tttaggagcgttcataaagacaaaaaaatagggattttgtatttagacgcgcatgcggat
attcatacggcttatgacagcgattcaaagcatatccacggcatgcctttaggcatggtt
ttaaatcgtgtccgtagcgggtttaatcgcatgagcgagagcgaagaaaaggcatggcaa
aagctctgctctttggggttagaaaagggagggctagaaattgatcctaaatgtttggtg
tattttggggtaagaagcaccgaacagagcgaaagagatgtgattaaggaattgcaaatc
cctttatttagtgtggaagcgataagagaaaacatgcaagaagtggttcaaaaaaccaaa
gaatcattaaaagcggtggatattatttaccttagtctggatttagacattatggatggc
aagcttttcacttctaccggcgtgcgtgaaaataacgggctgagctttgatgagctcaag
caattactaggcttgcttttagaaagctttaaagacagattaaaagcgcttgaggtaacc
gaatacaaccccacggtgagcgtaaaacacaataacgaagaagaaaagcaggttttagag
atcttggatctcatcatcaatagctgtaaatttaaagataagaagcgatcttttgcaagg
agttactga

DBGET integrated database retrieval system