KEGG   Helicobacter felis: HFELIS_01910Help
Entry
HFELIS_01910      CDS       T01375                                 

Gene name
pcm
Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hfe  Helicobacter felis
Brite
Enzymes [BR:hfe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     HFELIS_01910 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 RrnaAD Methyltransf_11 Methyltransf_4 NodS Methyltransf_23 Methyltransf_12 Methyltransf_32 MoeA_C Methyltransf_9 tRNA_U5-meth_tr
Motif
Other DBs
NCBI-ProteinID: CBY82275
UniProt: E7ACU5
Position
complement(159693..160325)
Genome map
AA seq 210 aa AA seqDB search
MHRIQNAHMCADIAKHFPLEAPIKEAICAIPRAEFVPSKQLAYTLDALPMGADQFISSPL
TVAKMTQFLQPYQVDSVLEIGCGSGYQAMVLSKLFRRVFTIERIEKLLLEAKERFRKLKV
TNIHTKLGDGQQGWEQYAPYDRILLSACIPAIPQALSAQLEEGGLLVAPIGNQQSQQITR
FVKKNGVLIVESVLDQCLFVPIVSGVERGV
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgcatccaaaacgcgcacatgtgcgcagacatcgccaagcacttccccctagaa
gctcccattaaagaggcaatttgtgcgatcccccgcgcagaatttgtcccctctaaacaa
cttgcctataccctagacgctcttcccatgggcgcagatcaatttatcagctccccttta
accgtggctaagatgacgcaattcttacagccctatcaagtggatagcgtgctagagatc
ggctgtggaagcgggtatcaagcgatggtgctctccaaactctttaggcgggttttcacc
attgagcgcattgaaaaactcctattagaagccaaagagcgttttagaaaactcaaagtt
accaacatccacaccaaattaggcgatgggcaacagggctgggagcaatacgccccctac
gatcgaatcttgctctcagcttgtattccagccatcccccaagctttgagcgcgcagtta
gaagagggggggttattagtcgcgcccattggcaatcagcaaagccagcagatcacccgt
tttgttaaaaagaacggggttttgattgtggagagtgtgctcgatcaatgtctctttgtc
cccattgtaagcggggttgaaagaggggtttag

DBGET integrated database retrieval system