KEGG   Helicobacter felis: HFELIS_05870Help
Entry
HFELIS_05870      CDS       T01375                                 

Gene name
atoB2
Definition
(GenBank) acetyl-CoA acetyltransferase 2
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hfe  Helicobacter felis
Pathway
hfe00071  Fatty acid degradation
hfe00072  Synthesis and degradation of ketone bodies
hfe00280  Valine, leucine and isoleucine degradation
hfe00310  Lysine degradation
hfe00362  Benzoate degradation
hfe00380  Tryptophan metabolism
hfe00620  Pyruvate metabolism
hfe00630  Glyoxylate and dicarboxylate metabolism
hfe00640  Propanoate metabolism
hfe00650  Butanoate metabolism
hfe00900  Terpenoid backbone biosynthesis
hfe01100  Metabolic pathways
hfe01110  Biosynthesis of secondary metabolites
hfe01120  Microbial metabolism in diverse environments
hfe01130  Biosynthesis of antibiotics
hfe01200  Carbon metabolism
hfe01212  Fatty acid metabolism
hfe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hfe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HFELIS_05870 (atoB2)
   00630 Glyoxylate and dicarboxylate metabolism
    HFELIS_05870 (atoB2)
   00640 Propanoate metabolism
    HFELIS_05870 (atoB2)
   00650 Butanoate metabolism
    HFELIS_05870 (atoB2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HFELIS_05870 (atoB2)
   00072 Synthesis and degradation of ketone bodies
    HFELIS_05870 (atoB2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HFELIS_05870 (atoB2)
   00310 Lysine degradation
    HFELIS_05870 (atoB2)
   00380 Tryptophan metabolism
    HFELIS_05870 (atoB2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HFELIS_05870 (atoB2)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HFELIS_05870 (atoB2)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HFELIS_05870 (atoB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hfe04147]
    HFELIS_05870 (atoB2)
Enzymes [BR:hfe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HFELIS_05870 (atoB2)
Exosome [BR:hfe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HFELIS_05870 (atoB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CBY82671
UniProt: E7AAE9
Position
571090..572274
Genome map
AA seq 394 aa AA seqDB search
MKNLHEVYVYSAKRSPIGSFNGSLSSVPATTLGSVVGVEALKASGFDSGLVDTCIVGNVI
SAGLKQAPARQVALNAHLPNSVGCFLINEACGSGLRAVMLGASEIALGRSRVALVGGIEN
MSLAPHLLMGSRGGFKMGDAKLEDSLFKDGLRDAYQYALMGDFAEGCAKNHRLSREEQDH
FAKHSYEKALEAIKTQAFDSEIVPISIKSKKGEELVSLDEEPSKVNFEKGLKLKPAFDKE
GTITAFNASKISDGASMLVIASKELAKDTSTKPLAKILDYNSFSHDPHLFPTAPAPAIQK
LLERNHKKVSDIDLYEISEAFAVVGLLTQRELELKDTQINVHGGAIALGHPIGASGARIL
TTLVHALHRHDKHLGVACLCVGGGEAVAMLIERL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacttgcacgaagtctatgtttatagcgcgaaacgaagccctattgggtctttt
aatggaagtttatccagtgtgccagccacgacgctaggaagtgtggtgggtgtggaagca
ctcaaagcgagcgggtttgattctggcttggtggatacatgtattgtaggcaatgtgatt
agtgcgggtttgaagcaggctcctgctaggcaggtcgccctgaacgcccatttgcctaat
tctgtgggttgctttttgattaacgaggcgtgtgggtctggcttgagggcggtgatgttg
ggtgcgagtgaaatcgccttagggcgatctagggtggctttagtaggagggattgaaaac
atgagcctagcccctcatttgttgatggggagtagaggggggtttaaaatgggcgatgcc
aaattagaggacagcttgtttaaagatggtttgcgcgatgcttaccaatatgccttaatg
ggggattttgccgaggggtgcgctaaaaaccaccgcttgagcagagaagagcaggatcat
tttgctaaacatagctatgaaaaagctcttgaggcgatcaagactcaggcttttgattct
gagatcgtgcccattagcattaaaagcaaaaaaggggaggagctagttagcctagatgaa
gagcccagcaaagttaattttgaaaaaggtttaaaactcaagcccgcctttgataaagag
ggcacgatcaccgcttttaatgccagcaaaattagcgatggagcgagtatgttggtcatt
gctagcaaggagctagcaaaagacacctctaccaaacccttagctaaaatcctagattac
aactctttcagccacgatccccatctcttccccactgcgcctgctcctgctattcaaaag
ctcttagaaagaaaccacaaaaaagttagcgatattgatctctatgaaatcagcgaggct
tttgcagtggtgggactcttaacccaaagagaattggagcttaaagatactcaaatcaat
gtacatgggggagcgatcgcgctagggcaccccataggagctagtggcgcgcgtattctc
accacccttgtacatgccttgcacagacatgacaaacacttaggcgtggcgtgtctgtgt
gtaggcggtggcgaagcagtcgcaatgctcattgagagattatag

DBGET integrated database retrieval system