KEGG   Helicobacter felis: HFELIS_06870Help
Entry
HFELIS_06870      CDS       T01375                                 

Definition
(GenBank) spermidine synthase
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
hfe  Helicobacter felis
Pathway
hfe00270  Cysteine and methionine metabolism
hfe00330  Arginine and proline metabolism
hfe00410  beta-Alanine metabolism
hfe00480  Glutathione metabolism
hfe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hfe00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    HFELIS_06870
   00330 Arginine and proline metabolism
    HFELIS_06870
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HFELIS_06870
   00480 Glutathione metabolism
    HFELIS_06870
Enzymes [BR:hfe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     HFELIS_06870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spermine_synth
Motif
Other DBs
NCBI-ProteinID: CBY82771
UniProt: E7AAV0
Position
complement(669326..670045)
Genome map
AA seq 239 aa AA seqDB search
MTHHLEIVGTDCAQVGIVRHDTQEWMFFQNYPFIQSELLAHVSACVHPNPKRALITGGFD
TQIAFELLKHEDMHVDFVQEDRAMLENLHTFLPQFQETKTHARFKLYDRILDLDLQPYDI
IISLSTLNAHQVDGLQRMLAPRGFMVSVAPSPLLEQEAFKDTLKDLQTCAQILMPFNTPY
APTPQIYLFISKHYHPLADMLLQKIDMLDGLRYYNAEIHHAAFAQPQWLKGACARLLKN
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgacacaccatttagaaattgtcggaacagattgtgcacaagtagggatcgtgcgtcat
gacacacaggaatggatgttttttcaaaattatccctttattcaaagtgagttattggca
catgtgagcgcgtgcgtgcaccccaaccctaaacgcgcgctcattaccggagggtttgat
acccaaatcgcttttgaattgctaaagcacgaagacatgcatgtagattttgtgcaagaa
gatcgcgcaatgttagaaaacctacacacctttttgcctcaatttcaagagactaaaacc
catgcgcgcttcaagctttatgataggattttagacctagatttacagccctatgacatt
atcatctctttaagcaccctcaacgcccaccaagtggacggcttgcaacgcatgctagcc
cctaggggtttcatggtctcagtcgctcctagtcctcttctcgagcaagaagcctttaag
gacacgctcaaagatttgcaaacctgtgcgcaaattctgatgccttttaacaccccctac
gctcccacgcctcagatttatctttttatttctaaacattaccaccccctagcggatatg
ttgctccaaaaaatcgacatgctcgatggcttgcgttactataatgctgaaatccaccat
gctgcctttgcccagcctcagtggctcaagggcgcgtgcgcgcgtttgcttaaaaattga

DBGET integrated database retrieval system