KEGG   Helicobacter felis: HFELIS_07210Help
Entry
HFELIS_07210      CDS       T01375                                 

Gene name
metS
Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
hfe  Helicobacter felis
Pathway
hfe00450  Selenocompound metabolism
hfe00970  Aminoacyl-tRNA biosynthesis
hfe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hfe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    HFELIS_07210 (metS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HFELIS_07210 (metS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hfe01007]
    HFELIS_07210 (metS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hfe03016]
    HFELIS_07210 (metS)
Enzymes [BR:hfe01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     HFELIS_07210 (metS)
Amino acid related enzymes [BR:hfe01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   HFELIS_07210 (metS)
Transfer RNA biogenesis [BR:hfe03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    HFELIS_07210 (metS)
 Prokaryotic type
   Other AARSs
    HFELIS_07210 (metS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f zinc-ribbons_6 Toprim
Motif
Other DBs
NCBI-ProteinID: CBY82805
UniProt: E7AB45
Position
706764..708611
Genome map
AA seq 615 aa AA seqDB search
MQKLVTTPIYYVNDVPHLGHAYTTFIADMLKKYYALRADDVFLLTGTDEHGQKIAQSALK
HQVSPLEYASKISSKFRDQWDFFGIDYDHFIRTTDDSHMFAVQYAFEAMLARGDIYKGTY
KGAYCVSCESFVTGEARCPDCQRETSILEEESYFFALSKYQDRLLDFYAKNPKTILPTYR
THEVLRFIEQGLHDLSITRTSFEWGIKLPKNLNDPKHVVYVWLDALLNYVSALGYPNGGK
MGYFDHAIHVVGKDILRFHAIYWPAFLMSLELPLFKHLCVHGWWTIEGVKMSKSIGNVLC
AQSIAQTYGRDVLRYFLLREVPLGQDGDFSQEALLRRANADLSNTLGNLVQRLSGMAGRY
FEGRVQSTHTLEHYKEDYETLHALFAPLDGHMEAMQPHKYLEDLWKVFEGANALIARTEP
WKMQDQTKIMALLGLIATLLVKSVYYLYPIIPESAQKLATLLGVELSPKGFSAICEQKPL
SLVLEKTPPLFPRQEPPKTPAPAPASSMPTICIKDFQKLDLRVGRVLQAERLQGSDKLLL
LKVDFGDRTRTILSGIAKHYQPQDLEGKQVCAVLNLEPRKMLGVVSEGMILSAQDQEGLH
LIAPCSAVKEGSSIS
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagctcgttactacacctatttattatgtcaatgatgtcccacatttaggacat
gcttacacaacttttattgcggatatgctcaaaaaatattatgccctgcgcgctgatgat
gtttttttactcactggcactgatgagcatgggcaaaagatcgcccaaagcgcgctcaaa
caccaagtaagccctttagaatacgcctccaagatcagttctaaattccgcgatcaatgg
gatttttttggaattgattatgatcactttatccgcactacggatgactctcatatgttt
gctgtgcagtatgcctttgaggcgatgttagcacggggggatatttacaaaggcacttac
aagggggcttattgtgtgagctgtgagagctttgtaactggggaggcgcgctgtccggat
tgtcagagagaaacgagtatcttagaagaagagagttatttttttgccctaagcaagtat
caagatcgccttttggatttctatgccaaaaatcccaagaccattttgcccacctatagg
acgcatgaggttttgcgcttcattgagcagggcttgcacgatctctcgatcacacgcaca
agttttgaatgggggatcaaattgcccaagaatcttaacgatcctaaacatgttgtctat
gtgtggttggacgcgttgctaaactatgtaagcgcgttgggttaccctaatggggggaaa
atgggctattttgatcatgcaatccatgttgtgggtaaggatattttgcgcttccatgcc
atctattggcccgcttttttgatgagtttagaactccctctttttaaacatctctgcgtg
catgggtggtggaccattgagggggtgaaaatgagcaagagtattggcaatgtgctctgt
gctcaaagcatagcgcaaacctatggcagggatgtattgcgttattttctcttgcgcgaa
gtgcctttaggacaagatggggatttctcccaagaagcccttttgcgccgtgccaatgcg
gatttaagcaacacgctaggcaatttagtgcaaagactgagtggcatggcggggcgttac
tttgaggggcgtgtgcaaagcactcatacccttgagcactacaaagaagactatgaaact
ttgcatgcgctttttgcccccttagatgggcatatggaggcgatgcaaccgcataaatac
cttgaggatttatggaaggtctttgagggcgcgaacgccttaattgcgcgcacagagcct
tggaaaatgcaagatcaaacaaagatcatggcgttattgggtttgatagccacgctttta
gttaaatctgtctactatctctaccccattatcccagagagtgcgcaaaaattagccaca
ttgctgggtgtggaattgagtcctaaaggctttagtgcgatctgtgagcaaaagcccctc
tcccttgtgttagaaaaaactccgcccctcttcccccgccaagagccccctaaaacccct
gcccccgccccagcttctagcatgcccaccatctgcattaaggattttcaaaagttagat
ttgcgcgtggggcgcgttttgcaggcagaaaggcttcaaggaagtgataaactcttgtta
ttgaaagtagattttggagatcgcacgcgcaccattttatcaggcattgccaagcactac
caaccacaagatttagagggtaagcaggtttgcgcggtgttgaatttagagcctagaaaa
atgttaggtgtggtgagtgaggggatgatcttaagcgcacaagatcaagaaggcttgcac
ctcatcgccccttgtagcgcggttaaagaggggagttctattagctag

DBGET integrated database retrieval system