KEGG   Helicobacter felis: HFELIS_14220Help
Entry
HFELIS_14220      CDS       T01375                                 

Definition
(GenBank) possible phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
hfe  Helicobacter felis
Brite
KEGG Orthology (KO) [BR:hfe00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    HFELIS_14220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF1129
Motif
Other DBs
NCBI-ProteinID: CBY83506
UniProt: E7AAD3
Position
complement(1400432..1402045)
Genome map
AA seq 537 aa AA seqDB search
MKAKDASPLKKAFKDLQRDNVKITLAVVFVVCIAGMSLVLGHVHIHLPLLALATVVGGYM
AMNIGANDVANNVGPLVGSQAITLGMAILLAAICEVLGAVLAGADVVQSIKGKIINPAHI
HDSAVFVGMMLSALLSGAIWLHLATAIGAPVSTTHSIVGGVLGAGLMAGGVGAVEWHFLG
GIVASWVISPVMGGGIAMGLLAGIKHVLSDKEDKKQAAMQVMPILVGIMGMAFTWYMFAK
VLNKKLPFMLQGWQDILLSFIAGLCVFWIFKSYVAKKLPGLENTRESVHTLFTYPLIFGA
ALLSFAHGANDVANAVGPLAAIVQSLQQWGQNTIPTSAYAPMWIMLIGGMGIALGLSLYG
PKLIKTVGSEITELDKMQAFCIAMATVITVLFASKLGLPVSSTHITIGAVFGVGFLREML
HRRTLEMKQMILDAHAGEDASVIKNFLERFEKASPQQKKEMLAYLKALKKDNNTLEYSIG
LSKKERKSLKKAYKSELVKRSVIKKIVTAWLITVPISTLLGALGYYLIDVFGVVGRL
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccaaagacgcttctccacttaaaaaagcctttaaagacctccaaagagataat
gtcaagatcactttggctgttgtgtttgtggtgtgtatcgcgggcatgtctttagtctta
gggcatgtgcacatacaccttcctttgctcgctttggcgactgtggtgggggggtatatg
gcgatgaacatcggggctaacgatgtcgccaataatgtagggcctctagtgggctctcaa
gcgatcactttgggcatggcgattttactggccgctatttgcgaagttttaggggctgtg
ctagcaggtgcggatgtggtgcaaagcatcaagggtaaaattatcaaccctgcacacatc
catgatagcgcagtttttgtaggcatgatgctctctgctctgctttcaggggctatttgg
ttgcacttggccactgctattggcgcgcctgtttctaccacacactctattgtagggggg
gtgttgggagcaggtttgatggccggaggtgtgggggctgtcgagtggcatttcttggga
ggaattgtagctagttgggtcatttctccggtaatgggggggggaattgctatgggtctg
cttgctggcatcaaacatgttttaagcgacaaagaagataaaaaacaagctgccatgcaa
gtgatgcccattttagtgggaatcatgggtatggcctttacttggtatatgtttgccaaa
gttttaaacaaaaagttaccttttatgttgcagggatggcaggacattctcttaagcttc
atagcaggtttgtgtgtcttttggatctttaaatcctatgttgctaaaaaacttcctggt
ttagaaaacaccagagagagtgtgcacactcttttcacctacccgcttatttttggcgcg
gccttgttaagttttgcgcacggagctaatgatgtagccaatgctgtaggccctttagca
gctattgtgcagagtttgcaacaatgggggcagaataccattcctacgagtgcttacgcg
cccatgtggatcatgctcattggggggatggggatcgctttaggcctaagcctttatggc
cccaaactcattaaaaccgtggggagtgagattacagaactagacaaaatgcaggctttt
tgtatcgcgatggcgactgtgattaccgtgctttttgcctctaaattaggtttgcctgta
agctcgactcatatcactatcggagcggtttttggggtgggttttctgcgtgagatgttg
cataggcgcaccctagagatgaagcaaatgatcttagatgcccatgctggcgaagatgct
agcgtgattaaaaatttcttagaacgctttgaaaaggccagtccccaacaaaaaaaggag
atgttagcctatcttaaagcactcaaaaaagataataataccctagagtactctataggt
ttgagtaagaaagagcgcaaatcgctcaaaaaagcttataagagcgagcttgttaagcgt
tctgtgatcaaaaagattgttacggcttggctgatcaccgtgcctatttctaccctgtta
ggagcgctaggatattatcttatcgatgtctttggtgttgtggggcgactctaa

DBGET integrated database retrieval system